DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT2 and GstT1

DIOPT Version :9

Sequence 1:NP_724816.3 Gene:GstT2 / 246386 FlyBaseID:FBgn0050005 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_610509.2 Gene:GstT1 / 35995 FlyBaseID:FBgn0050000 Length:228 Species:Drosophila melanogaster


Alignment Length:227 Identity:149/227 - (65%)
Similarity:182/227 - (80%) Gaps:0/227 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSKPIRFYYDLLSPIARGLWIGLKFSNSPVEYCPIALRKFEQLTDEYKKINRFQKVPAIVGGDFH 65
            |||.|::|||.||..:|.|||.:|...:|.|.||:||||.|||||||:.|||||||||||.|.|.
  Fly     1 MSKAIKYYYDFLSQPSRALWIAMKLGKTPFEDCPVALRKQEQLTDEYRSINRFQKVPAIVDGKFQ 65

  Fly    66 LSETIAIIRYLADKGQFDEKLYPKTLENRARVDEFLEWQHLNIRLACSMYFRDAWLFPMNGIAPK 130
            |.|:::|:|||||||.|.|:|||||||.||||||||||||.|:||.||::||..||.|..|:||.
  Fly    66 LGESVSIVRYLADKGVFSEQLYPKTLEERARVDEFLEWQHFNVRLVCSLFFRQVWLLPAKGLAPA 130

  Fly   131 PKPEQIQALIEGVENNLGLLERLWLENDFLVGKNLTMADILGSSEINQLRLCQYRVDEKKFPKVV 195
            ||||.::.||:.||:|||||||||||.|||||..||:|||.|||||||::||||.|:||:||||.
  Fly   131 PKPESVKKLIKDVESNLGLLERLWLEKDFLVGDKLTVADIFGSSEINQMKLCQYNVNEKQFPKVA 195

  Fly   196 KWLERVRVSANPYHDEGLTFIDRKSKQSTAAK 227
            ||:||||.:.|||:||..:|:.:.|:|:..||
  Fly   196 KWMERVRDATNPYYDEAHSFVYKTSQQAVKAK 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT2NP_724816.3 GST_N_Theta 5..80 CDD:239348 47/74 (64%)
GstA 7..202 CDD:223698 133/194 (69%)
GST_C_family 93..218 CDD:295467 84/124 (68%)
GstT1NP_610509.2 GstA 5..204 CDD:223698 136/198 (69%)
GST_N_Theta 5..80 CDD:239348 47/74 (64%)
GST_C_Theta 93..218 CDD:198292 84/124 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446150
Domainoid 1 1.000 64 1.000 Domainoid score I3657
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 117 1.000 Inparanoid score I2004
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54888
OrthoDB 1 1.010 - - D106508at33392
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm1047
orthoMCL 1 0.900 - - OOG6_100130
Panther 1 1.100 - - P PTHR43917
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
1211.810

Return to query results.
Submit another query.