DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT2 and GstE13

DIOPT Version :9

Sequence 1:NP_724816.3 Gene:GstT2 / 246386 FlyBaseID:FBgn0050005 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_001188889.1 Gene:GstE13 / 35928 FlyBaseID:FBgn0033381 Length:226 Species:Drosophila melanogaster


Alignment Length:214 Identity:56/214 - (26%)
Similarity:97/214 - (45%) Gaps:35/214 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSKPIRFYYDLLSPIARGLWIGLKFSNSPVEYCPIALRKFEQLTDEYKKINRFQKVPAIVGGDFH 65
            |||| ..||.|.||.||...:..|.....:|..|:...|.|.|::|:.|:|...::|..|..|..
  Fly     1 MSKP-TLYYALFSPPARACILVAKLIGLDLELKPVDFAKKEHLSEEFVKLNPQHQIPVFVDSDGE 64

  Fly    66 L-SETIAIIRYLADKGQFDEKLYPKTLENRARVDEFLEWQHLNIRLACSMYFRDAWLFPMNGIAP 129
            : .::.||:.:|..|...:::|||:.|:.||.:|..:.::                    ||:..
  Fly    65 VYVDSHAIVCFLVAKYAGNDQLYPRDLKRRAHIDHRMHYE--------------------NGVLF 109

  Fly   130 KPKPEQIQALIEGVE------------NNLGLLERLWLENDFLVGKNLTMADILGSSEINQLRLC 182
            :...:.:...|.|.|            |....||....:..|:||..|::||:...:.:..|.|.
  Fly   110 QVVKDIVARNIYGGEGEYNPRSLTLCHNAYSDLEHFLQQGSFVVGNELSVADVSIHTTLVTLDLL 174

  Fly   183 QYRVDEKKFPKVVKWLERV 201
             ..|:.:|:|:..:|:||:
  Fly   175 -IPVEREKYPQTKQWMERM 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT2NP_724816.3 GST_N_Theta 5..80 CDD:239348 22/75 (29%)
GstA 7..202 CDD:223698 52/208 (25%)
GST_C_family 93..218 CDD:295467 25/121 (21%)
GstE13NP_001188889.1 GST_N_Delta_Epsilon 4..78 CDD:239343 23/74 (31%)
GST_C_Delta_Epsilon 92..211 CDD:198287 25/122 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460090
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
65.750

Return to query results.
Submit another query.