DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT2 and clic1

DIOPT Version :9

Sequence 1:NP_724816.3 Gene:GstT2 / 246386 FlyBaseID:FBgn0050005 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_997847.1 Gene:clic1 / 324481 ZFINID:ZDB-GENE-030131-3202 Length:241 Species:Danio rerio


Alignment Length:175 Identity:38/175 - (21%)
Similarity:67/175 - (38%) Gaps:55/175 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 LWI-GLKFSNSPVEYCPIALRKFEQLTDEYKKINRFQKVPAIVGGDFHLSETIAIIRYLADKGQF 82
            ||: |:.|:.:.|:    ..||.|.|.|    :....:.|.::.|....::|..|..:|      
Zfish    34 LWLKGVTFNVTTVD----MKRKPEILKD----LAPGAQPPFLLYGTEVKTDTNKIEEFL------ 84

  Fly    83 DEKL----YPKTL-----ENRARVDEFLEWQHLNIRLACSMYFRDA--------------WLFPM 124
            :|.|    ||:..     .|.|.:|.|.::         |.|.:::              .|..:
Zfish    85 EETLCPPKYPRLAACNPESNTAGLDVFSKF---------SAYIKNSNPQMNDNLEKGLLKALKKL 140

  Fly   125 NGIAPKPKPEQIQALIEGVENNLGLLERLWLENDFLVGKNLTMAD 169
            :.....|.|::|.      ||:..  :.:.....||.|:.||:||
Zfish   141 DDYLSSPLPDEID------ENSAD--DVISSTRSFLDGQELTLAD 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT2NP_724816.3 GST_N_Theta 5..80 CDD:239348 15/61 (25%)
GstA 7..202 CDD:223698 38/175 (22%)
GST_C_family 93..218 CDD:295467 19/91 (21%)
clic1NP_997847.1 GST_N_CLIC 3..93 CDD:239359 17/72 (24%)
O-ClC 6..241 CDD:129941 38/175 (22%)
GST_C_CLIC1 100..238 CDD:198333 19/95 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589584
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.