DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT2 and Gdap1l1

DIOPT Version :9

Sequence 1:NP_724816.3 Gene:GstT2 / 246386 FlyBaseID:FBgn0050005 Length:228 Species:Drosophila melanogaster
Sequence 2:XP_038961050.1 Gene:Gdap1l1 / 311616 RGDID:1304960 Length:369 Species:Rattus norvegicus


Alignment Length:233 Identity:45/233 - (19%)
Similarity:83/233 - (35%) Gaps:69/233 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 IALRKFEQLTDEYKKINRFQKVPAIVGGDFHLSETIAIIRYL--ADKGQFDEKLYPKT-LENRAR 96
            ::|.:.|.....:.::|..::||.|:..|..:|:...||.|:  ...|:....|.|:. ....||
  Rat    80 VSLPQSEHKEPWFMRLNLGEEVPVIIHRDNIISDYDQIIDYVERTFTGEHVVALMPEAGSPQHAR 144

  Fly    97 VDEFLEWQHLNIRLACSMYFRDAWLFP---MNGIAPKPKPEQIQALIEGVENNL----------- 147
            |   |:::.|...|....|.....|.|   .:.:.||....:|:..:.....:|           
  Rat   145 V---LQYRELLDALPMDAYTHGCILHPELTTDSMIPKYATAEIRRHLANATTDLMKLDHEEPQLS 206

  Fly   148 --------------------------------------GLLERLWLEND------FLVGKNLTMA 168
                                                  ..||:..|||:      :|.|...|:|
  Rat   207 EPYLSKQKKLMAKILEHDDVGYLKKILGELAMVLDQIEAELEKRKLENEGQTCELWLCGCAFTLA 271

  Fly   169 DILGSSEINQLRLC----QYRVDEKKFPKVVKWLERVR 202
            |:|..:.:::|:..    :|..|..: |.:..:.|||:
  Rat   272 DVLLGATLHRLKFLGLSKKYWEDGSR-PNLQSFFERVQ 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT2NP_724816.3 GST_N_Theta 5..80 CDD:239348 11/46 (24%)
GstA 7..202 CDD:223698 44/231 (19%)
GST_C_family 93..218 CDD:295467 31/172 (18%)
Gdap1l1XP_038961050.1 Thioredoxin_like 47..122 CDD:412351 11/41 (27%)
GST_C_family 203..313 CDD:413470 18/107 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166348082
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.