DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT2 and Gsto2

DIOPT Version :9

Sequence 1:NP_724816.3 Gene:GstT2 / 246386 FlyBaseID:FBgn0050005 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_001012071.1 Gene:Gsto2 / 309465 RGDID:1310764 Length:248 Species:Rattus norvegicus


Alignment Length:205 Identity:43/205 - (20%)
Similarity:66/205 - (32%) Gaps:77/205 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 VEYCPIALR-----KFEQLTDEYKKIN------------RFQKVPAIVGGDFHL-SETIAIIRYL 76
            :.:||.:.|     |.:.:..|...||            .|.:||.:......| .|::....||
  Rat    29 MRFCPYSHRTRLVLKAKSIRHEIININLKNKPDWYYTKHPFGQVPVLENSQCQLIYESVIACEYL 93

  Fly    77 AD--KGQFDEKLYPKTLENRARVDEFLEWQHLNIRLACSMYFRDAWLFPMNGIAPKPKPEQIQAL 139
            .|  .|:   ||:|.....|||       |.:.:.|.|.:              |:...|.:.||
  Rat    94 DDVFPGR---KLFPYDPYERAR-------QKMLLELFCKV--------------PQLSKECLVAL 134

  Fly   140 IEG---------VENNLGLLERL--WLENDFLVGKNLTMADILGSSEINQLRLCQYRVDEKKFPK 193
            ..|         :...|..||.:  :....|..|.:::|.|.|                      
  Rat   135 RCGRDCTDLKVALRQELCNLEEILEYQNTTFFGGDSISMIDYL---------------------- 177

  Fly   194 VVKWLERVRV 203
            |..|.||:.|
  Rat   178 VWPWFERLDV 187

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstT2NP_724816.3 GST_N_Theta 5..80 CDD:239348 15/69 (22%)
GstA 7..202 CDD:223698 42/202 (21%)
GST_C_family 93..218 CDD:295467 24/122 (20%)
Gsto2NP_001012071.1 GST_N_Omega 7..94 CDD:239353 13/64 (20%)