Sequence 1: | NP_724816.3 | Gene: | GstT2 / 246386 | FlyBaseID: | FBgn0050005 | Length: | 228 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_788267.2 | Gene: | Clic6 / 304081 | RGDID: | 727938 | Length: | 613 | Species: | Rattus norvegicus |
Alignment Length: | 235 | Identity: | 48/235 - (20%) |
---|---|---|---|
Similarity: | 72/235 - (30%) | Gaps: | 103/235 - (43%) |
- Green bases have known domain annotations that are detailed below.
Fly 45 DEYKKIN-RFQKVPAIVGGDFHLSETIAIIRYLADKGQ------FDEKLY--------------- 87
Fly 88 -----PKTLENRA-------------------RVDEFLE------------WQHLNIRLACSMYF 116
Fly 117 -----------RDAWLFPMNGIAPK---------------PKPEQIQAL-IEGVENNLGLLERLW 154
Fly 155 LENDFLVGKNLTMAD--ILGSSEINQLRLCQYRVDEKKFP 192 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
GstT2 | NP_724816.3 | GST_N_Theta | 5..80 | CDD:239348 | 8/35 (23%) |
GstA | 7..202 | CDD:223698 | 48/235 (20%) | ||
GST_C_family | 93..218 | CDD:295467 | 35/160 (22%) | ||
Clic6 | NP_788267.2 | 2A1904 | <51..318 | CDD:273344 | |
O-ClC | 380..613 | CDD:129941 | 41/209 (20%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C166348019 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |