DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT2 and Clic6

DIOPT Version :9

Sequence 1:NP_724816.3 Gene:GstT2 / 246386 FlyBaseID:FBgn0050005 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_788267.2 Gene:Clic6 / 304081 RGDID:727938 Length:613 Species:Rattus norvegicus


Alignment Length:235 Identity:48/235 - (20%)
Similarity:72/235 - (30%) Gaps:103/235 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 DEYKKIN-RFQKVPAIVGGDFHLSETIAIIRYLADKGQ------FDEKLY--------------- 87
            :|..::| |.:..||...||......|.:.......|:      |.::|:               
  Rat   354 EELGRVNGRRENGPASEEGDLGQEHDITLFVKAGSDGESIGNCPFSQRLFMILWLKGVIFNVTTV 418

  Fly    88 -----PKTLENRA-------------------RVDEFLE------------WQHLNIRLACSMYF 116
                 |..|:|.|                   :::||||            .||.....|.:..|
  Rat   419 DLKRKPADLQNLAPGTNPPFMTFDGEVKTDVNKIEEFLEEKLVPPRYPKLGTQHPESNSAGNDVF 483

  Fly   117 -----------RDAWLFPMNGIAPK---------------PKPEQIQAL-IEGVENNLGLLERLW 154
                       :||     |.|..|               |.|::|.|. .|.|..:        
  Rat   484 AKFSAFIKNTKKDA-----NDIYEKNLLRALKKLDSYLNSPLPDEIDAYSTEDVTVS-------- 535

  Fly   155 LENDFLVGKNLTMAD--ILGSSEINQLRLCQYRVDEKKFP 192
             :..||.|..||:||  :|....|.::...:||..|  ||
  Rat   536 -QRKFLDGDELTLADCNLLPKLHIIKIVAKKYRGFE--FP 572

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT2NP_724816.3 GST_N_Theta 5..80 CDD:239348 8/35 (23%)
GstA 7..202 CDD:223698 48/235 (20%)
GST_C_family 93..218 CDD:295467 35/160 (22%)
Clic6NP_788267.2 2A1904 <51..318 CDD:273344
O-ClC 380..613 CDD:129941 41/209 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166348019
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.