DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT2 and Clic3

DIOPT Version :9

Sequence 1:NP_724816.3 Gene:GstT2 / 246386 FlyBaseID:FBgn0050005 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_001013098.2 Gene:Clic3 / 296566 RGDID:1307249 Length:237 Species:Rattus norvegicus


Alignment Length:196 Identity:39/196 - (19%)
Similarity:64/196 - (32%) Gaps:75/196 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 LWIGLKFSNSPVEYCPIALRKFEQLTDEYKKINRFQKVPAIVGGDFHLS-----ETIAIIRYLAD 78
            |::........|.:||...|.|              .|..:.|..|.|:     ..:.:::..|.
  Rat     9 LFVKASEDGESVGHCPSCQRLF--------------MVLLLKGVPFTLTTVDTRRALDVLKDFAP 59

  Fly    79 KGQFDEKLYPKTLE-NRARVDEFLEWQHLNIRLACSMYFRDAWLFPMN--GIAPK---------- 130
            ..|....||...:: :..:::||||                ..|.|.:  |:||:          
  Rat    60 GSQLPILLYDGDVKTDTLQIEEFLE----------------ETLGPPDFPGLAPRYRESNTAGND 108

  Fly   131 -----------PKPEQIQALIEGVENNLGLLERLW---LEND-------------FLVGKNLTMA 168
                       |.|.|..||.:.:...|..|:|..   |:::             ||.|..||:|
  Rat   109 IFHKFSAFIKNPVPTQDDALYQQLLRALTRLDRYLGTPLDHELAQEPHLSESRRRFLDGDQLTLA 173

  Fly   169 D 169
            |
  Rat   174 D 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT2NP_724816.3 GST_N_Theta 5..80 CDD:239348 11/65 (17%)
GstA 7..202 CDD:223698 39/196 (20%)
GST_C_family 93..218 CDD:295467 25/116 (22%)
Clic3NP_001013098.2 O-ClC 6..230 CDD:129941 39/196 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166348073
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.