DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT2 and Gstm6l

DIOPT Version :9

Sequence 1:NP_724816.3 Gene:GstT2 / 246386 FlyBaseID:FBgn0050005 Length:228 Species:Drosophila melanogaster
Sequence 2:XP_038958005.1 Gene:Gstm6l / 295362 RGDID:1311731 Length:235 Species:Rattus norvegicus


Alignment Length:228 Identity:54/228 - (23%)
Similarity:100/228 - (43%) Gaps:52/228 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 PIARGLW----IG------LKFSNSPVEYCPIAL------RKFEQLTDEYKKINRFQKVPAIVGG 62
            |:..|.|    :|      |:::.|..|.....:      .:.:.|::::|.......:|.::.|
  Rat     2 PMTLGYWDIRGLGQAIRLLLEYTGSSYEEKRYTMGDAPDYDRSQWLSEKFKLGLDIPNLPYLIDG 66

  Fly    63 DFHLSETIAIIRYLADKGQFDEKLYPKTLENRARVDEFLEWQHLNIRLACSM--YFRDAWLF-PM 124
            ...::::.||:|||..|    ..|..:|.|.|.||| .||.|.::.|...||  |..|..|: |:
  Rat    67 SHKITQSNAILRYLGRK----HNLCGETEEERLRVD-ILENQAVDTRRQLSMVCYSPDLCLWEPV 126

  Fly   125 NGIA-------PKPKPEQIQALIEGVENNLGLLERLWLENDFL------VGKNLTMADILGSSEI 176
            :.|.       .|.|||.::          ||.:::.|.::||      .|..:|..|.|....:
  Rat   127 SRIGIVFSPPQEKRKPEYLE----------GLPDKMKLYSEFLGKQLWFAGNKITYVDFLVYDVL 181

  Fly   177 NQLRLCQYRVDEKKFPKVVKWLERV----RVSA 205
            ::.|:.:.:..: .||.:..::.|.    ::||
  Rat   182 DKHRMFELKCLD-AFPNLKDFMARFETLEKISA 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT2NP_724816.3 GST_N_Theta 5..80 CDD:239348 16/81 (20%)
GstA 7..202 CDD:223698 52/223 (23%)
GST_C_family 93..218 CDD:295467 34/133 (26%)
Gstm6lXP_038958005.1 GST_N_Mu 3..84 CDD:239373 16/84 (19%)
GST_C_Mu 92..226 CDD:198318 35/134 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.