DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT2 and GSTT1

DIOPT Version :9

Sequence 1:NP_724816.3 Gene:GstT2 / 246386 FlyBaseID:FBgn0050005 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_000844.2 Gene:GSTT1 / 2952 HGNCID:4641 Length:240 Species:Homo sapiens


Alignment Length:204 Identity:69/204 - (33%)
Similarity:116/204 - (56%) Gaps:9/204 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IRFYYDLLSPIARGLWIGLKFSNSPVEYCPIALRKFEQLTDEYKKINRFQKVPAIVGGDFHLSET 69
            :..|.||||...|.::|..|.::.|.|...:.|.|.:.|:|.:.::|..:||||:..|||.|:|:
Human     3 LELYLDLLSQPCRAVYIFAKKNDIPFELRIVDLIKGQHLSDAFAQVNPLKKVPALKDGDFTLTES 67

  Fly    70 IAIIRYLADKGQFDEKLYPKTLENRARVDEFLEWQHLNIRLACSMYFRDAW---LFPMNGIAPKP 131
            :||:.||..|.:..:..||:.|:.||||||:|.|||..:|.:|   .|..|   :||: .:....
Human    68 VAILLYLTRKYKVPDYWYPQDLQARARVDEYLAWQHTTLRRSC---LRALWHKVMFPV-FLGEPV 128

  Fly   132 KPEQIQALIEGVENNLGLLERLWLEND-FLVGKNLTMADILGSSEINQLRLCQYRVDEKKFPKVV 195
            .|:.:.|.:..::..|.|||..:|:|. ||.|.::::||::..:|:........:|.|.: ||:.
Human   129 SPQTLAATLAELDVTLQLLEDKFLQNKAFLTGPHISLADLVAITELMHPVGAGCQVFEGR-PKLA 192

  Fly   196 KWLERVRVS 204
            .|.:||..:
Human   193 TWRQRVEAA 201

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstT2NP_724816.3 GST_N_Theta 5..80 CDD:239348 28/74 (38%)
GstA 7..202 CDD:223698 68/198 (34%)
GST_C_family 93..218 CDD:295467 37/116 (32%)
GSTT1NP_000844.2 GST_N_Theta 3..78 CDD:239348 28/74 (38%)