DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT2 and GSTM3

DIOPT Version :9

Sequence 1:NP_724816.3 Gene:GstT2 / 246386 FlyBaseID:FBgn0050005 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_000840.2 Gene:GSTM3 / 2947 HGNCID:4635 Length:225 Species:Homo sapiens


Alignment Length:233 Identity:49/233 - (21%)
Similarity:95/233 - (40%) Gaps:67/233 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 YYDLLSPIARGLWIGLKFSNSPVE----YCPIA--LRKFEQLTDEYKKINRFQKVPAIVGGDFHL 66
            |:|:.. :|..:.:.|:|:::..|    .|..|  ..:.:.|..::|....|..:|.::.|...:
Human    11 YWDIRG-LAHAIRLLLEFTDTSYEEKRYTCGEAPDYDRSQWLDVKFKLDLDFPNLPYLLDGKNKI 74

  Fly    67 SETIAIIRYLADKGQFDEKLYPKTLENRARVD----EFLEWQHLNIRLACSMYFRDAWLFPMNGI 127
            :::.||:||:|.|    ..:..:|.|.:.|||    :.::::...|||.   |..|         
Human    75 TQSNAILRYIARK----HNMCGETEEEKIRVDIIENQVMDFRTQLIRLC---YSSD--------- 123

  Fly   128 APKPKPEQIQALIEGVENNLGLLERLWL---ENDFLVGKNLTMADILGSSEINQLR--------- 180
            ..|.||:.::.|       .|.|::..:   :..:..|:.||..|.|....::|.|         
Human   124 HEKLKPQYLEEL-------PGQLKQFSMFLGKFSWFAGEKLTFVDFLTYDILDQNRIFDPKCLDE 181

  Fly   181 -------LCQYRVDEK-----------KFP---KVVKW 197
                   :|::...||           |.|   |:.:|
Human   182 FPNLKAFMCRFEALEKIAAYLQSDQFCKMPINNKMAQW 219

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstT2NP_724816.3 GST_N_Theta 5..80 CDD:239348 18/77 (23%)
GstA 7..202 CDD:223698 49/233 (21%)
GST_C_family 93..218 CDD:295467 28/142 (20%)
GSTM3NP_000840.2 GST_N_Mu 7..88 CDD:239373 19/81 (23%)