DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT2 and GSTT4

DIOPT Version :9

Sequence 1:NP_724816.3 Gene:GstT2 / 246386 FlyBaseID:FBgn0050005 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_001345593.1 Gene:GSTT4 / 25774 HGNCID:26930 Length:241 Species:Homo sapiens


Alignment Length:208 Identity:63/208 - (30%)
Similarity:99/208 - (47%) Gaps:15/208 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IRFYYDLLSPIARGLWIGLKFSNSPVEYCPIALRKFEQLTDEYKKINRFQKVPAIVGGDFHLSET 69
            :..|.||||...|.::|..|..:....:..:.|.|....:..|..||..:|:|::..|.|.|||:
Human     3 LELYMDLLSAPCRAVYIFSKKHDIQFNFQFVDLLKGHHHSKGYIDINPLRKLPSLKDGKFILSES 67

  Fly    70 IAIIRYLADKGQFDEKLYPKTLENRARVDEFLEWQHLNIRLACSMYFRDAWLFPMNGIAPKPKPE 134
            .||:.||..|........|.....|||||||:.|||...:|...   :..||   ..:.||...|
Human    68 AAILYYLCRKYSAPSHWCPPDPHARARVDEFVAWQHTAFQLPMK---KIVWL---KLLIPKITGE 126

  Fly   135 QIQA-----LIEGVENNLGLLERLWLEND-FLVGKNLTMADILGSSEINQLRLCQYRVDEKKFPK 193
            ::.|     .:|.|:|:|.|.|..:|::. |:.|..:::||::...|:.|.....|.|.... .|
Human   127 EVSAEKMEHAVEEVKNSLQLFEEYFLQDKMFITGNQISLADLVAVVEMMQPMAANYNVFLNS-SK 190

  Fly   194 VVKWLERVRVSAN 206
            :.:|  |::|..|
Human   191 LAEW--RMQVELN 201

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstT2NP_724816.3 GST_N_Theta 5..80 CDD:239348 24/74 (32%)
GstA 7..202 CDD:223698 61/200 (31%)
GST_C_family 93..218 CDD:295467 37/120 (31%)
GSTT4NP_001345593.1 Thioredoxin_like 3..78 CDD:320948 24/74 (32%)