DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT2 and SPCC1183.02

DIOPT Version :9

Sequence 1:NP_724816.3 Gene:GstT2 / 246386 FlyBaseID:FBgn0050005 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_587885.1 Gene:SPCC1183.02 / 2539015 PomBaseID:SPCC1183.02 Length:220 Species:Schizosaccharomyces pombe


Alignment Length:167 Identity:48/167 - (28%)
Similarity:75/167 - (44%) Gaps:20/167 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 QKVPAIVGGD-FHLSETIAIIRYLADKGQFDEK--LYPKTLENRARVDEFLEWQ-HLNIRLACSM 114
            ||:|..:|.| |.|||.|||::|..:||:.::|  |.|   .|.....|.|:|. .:|..:....
pombe    50 QKLPVFIGADGFELSEVIAIVKYFYEKGKHNDKEGLGP---VNEVEEAEMLKWMCFINFDIVTPQ 111

  Fly   115 YFRDAWLFPMNGIAP---KPKPEQIQALIEGVENNLGLLERLWLENDFLVGKNLTMADILGSSEI 176
            ..| .|:....|..|   ||..|.....|:    :|.:...|..:..:|||...|:||:...|  
pombe   112 NVR-PWVGMFRGNIPYEEKPFKESATRAID----SLKIPNELVKDRTYLVGDRFTLADLFFGS-- 169

  Fly   177 NQLRLCQYRVDEKKFPKVVKWLERVRVSANPYHDEGL 213
             .||:....:.::|..|.:..|.|..::.  :|...|
pombe   170 -LLRIFFNSIIDEKTRKELPHLTRYYITM--FHQAKL 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT2NP_724816.3 GST_N_Theta 5..80 CDD:239348 13/26 (50%)
GstA 7..202 CDD:223698 46/154 (30%)
GST_C_family 93..218 CDD:295467 30/125 (24%)
SPCC1183.02NP_587885.1 GST_N_EF1Bgamma 4..76 CDD:239342 13/25 (52%)
GstA 28..198 CDD:223698 46/160 (29%)
GST_C_EF1Bgamma_like 92..217 CDD:198290 29/122 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 47 1.000 Inparanoid score I2071
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.860

Return to query results.
Submit another query.