DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT2 and AIMP3

DIOPT Version :9

Sequence 1:NP_724816.3 Gene:GstT2 / 246386 FlyBaseID:FBgn0050005 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_660194.1 Gene:AIMP3 / 246507 FlyBaseID:FBgn0050185 Length:179 Species:Drosophila melanogaster


Alignment Length:166 Identity:34/166 - (20%)
Similarity:69/166 - (41%) Gaps:26/166 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 KINRFQKVPAIVGGDFHLSETIAIIRYLADKGQFDEKLYPKTLENRARVDEFLEWQHLNIRLACS 113
            ::|..|.|....|....::...:|:..||.:.:      .:|.:| :|....:|.|         
  Fly    22 QLNEEQVVTRTSGQKKSVAGFASILESLASESK------SETAQN-SRASREVEAQ--------- 70

  Fly   114 MYFRDAWL-FPMNGIAPKPKPEQIQALIEGVENNLGLLERLWLENDFLVGKNLTMADILGSSEIN 177
            :|   .|: |.:..:||..|.:.:...:      |....:|:....:|||..:|:||:.....|.
  Fly    71 VY---QWIEFSVLYVAPGSKDKYVSKQL------LADFNKLFASKSYLVGHFITLADLAVYYAIY 126

  Fly   178 QLRLCQYRVDEKKFPKVVKWLERVRVSANPYHDEGL 213
            .|......||::.:..:.:|.:.::..|:.:..|.|
  Fly   127 DLVKSLSPVDKEVYLNLSRWFDHLQNRADVHQGEPL 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT2NP_724816.3 GST_N_Theta 5..80 CDD:239348 7/30 (23%)
GstA 7..202 CDD:223698 31/153 (20%)
GST_C_family 93..218 CDD:295467 26/122 (21%)
AIMP3NP_660194.1 GST_C_AIMP3 65..166 CDD:198338 24/116 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.