DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT2 and Gstp3

DIOPT Version :9

Sequence 1:NP_724816.3 Gene:GstT2 / 246386 FlyBaseID:FBgn0050005 Length:228 Species:Drosophila melanogaster
Sequence 2:XP_030106733.1 Gene:Gstp3 / 225884 MGIID:2385078 Length:260 Species:Mus musculus


Alignment Length:203 Identity:46/203 - (22%)
Similarity:73/203 - (35%) Gaps:65/203 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 IALRKFEQLTDEYKKINRFQKVPAIVGGDFHLSETIAIIRYLADKGQFDEKLYPKTLENRARVD- 98
            :.|..:||.|  :|....|.::|....|:..|.::..|:|:|.  ..|.  ||.|..:..|.|| 
Mouse    84 VTLDVWEQGT--FKASCLFGQIPKFQDGELTLYQSNTILRHLG--RSFG--LYGKDQQEAALVDM 142

  Fly    99 -----EFL------EWQHLNIRLACSMYFRDAWLFPMNGIAPKPKPEQIQALIEGVENNLGLLER 152
                 |.|      :::|:                      .|...:|.|..:.|   :|...|.
Mouse   143 VNDGLEDLFRRIARQYRHI----------------------LKEGKDQYQKELPG---HLKPFET 182

  Fly   153 LWLEN----DFLVGKNLTMAD-----------ILGSSEINQLRL-CQYRVDEKKFPKVVKWLERV 201
            |..:|    .|:||..::.||           :|....:|...| ..|....|..||:..:||  
Mouse   183 LLAQNRGGQSFIVGDQISFADYRLLDVLLNLELLFPGYLNDFPLFSAYVARLKSRPKLKAFLE-- 245

  Fly   202 RVSANPYH 209
                :|.|
Mouse   246 ----SPEH 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT2NP_724816.3 GST_N_Theta 5..80 CDD:239348 12/44 (27%)
GstA 7..202 CDD:223698 44/194 (23%)
GST_C_family 93..218 CDD:295467 30/145 (21%)
Gstp3XP_030106733.1 Thioredoxin_like 63..126 CDD:381987 12/45 (27%)
GST_C_family 134..253 CDD:383119 30/147 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.