Sequence 1: | NP_724816.3 | Gene: | GstT2 / 246386 | FlyBaseID: | FBgn0050005 | Length: | 228 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_030106733.1 | Gene: | Gstp3 / 225884 | MGIID: | 2385078 | Length: | 260 | Species: | Mus musculus |
Alignment Length: | 203 | Identity: | 46/203 - (22%) |
---|---|---|---|
Similarity: | 73/203 - (35%) | Gaps: | 65/203 - (32%) |
- Green bases have known domain annotations that are detailed below.
Fly 35 IALRKFEQLTDEYKKINRFQKVPAIVGGDFHLSETIAIIRYLADKGQFDEKLYPKTLENRARVD- 98
Fly 99 -----EFL------EWQHLNIRLACSMYFRDAWLFPMNGIAPKPKPEQIQALIEGVENNLGLLER 152
Fly 153 LWLEN----DFLVGKNLTMAD-----------ILGSSEINQLRL-CQYRVDEKKFPKVVKWLERV 201
Fly 202 RVSANPYH 209 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
GstT2 | NP_724816.3 | GST_N_Theta | 5..80 | CDD:239348 | 12/44 (27%) |
GstA | 7..202 | CDD:223698 | 44/194 (23%) | ||
GST_C_family | 93..218 | CDD:295467 | 30/145 (21%) | ||
Gstp3 | XP_030106733.1 | Thioredoxin_like | 63..126 | CDD:381987 | 12/45 (27%) |
GST_C_family | 134..253 | CDD:383119 | 30/147 (20%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1231780at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.920 |