Sequence 1: | NP_724816.3 | Gene: | GstT2 / 246386 | FlyBaseID: | FBgn0050005 | Length: | 228 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001165053.1 | Gene: | Mars1 / 216443 | MGIID: | 1345633 | Length: | 910 | Species: | Mus musculus |
Alignment Length: | 218 | Identity: | 39/218 - (17%) |
---|---|---|---|
Similarity: | 75/218 - (34%) | Gaps: | 68/218 - (31%) |
- Green bases have known domain annotations that are detailed below.
Fly 34 PIALRKFE-------------------QLTDEYKKINRFQKVPAIVGGDFHLSETIAIIRYLA-D 78
Fly 79 KGQFDEKLYPKTL----ENRARVDEFLEWQHLNIRLACSMYFR----------------DAWLFP 123
Fly 124 MNGIAPKPKPEQIQALIEGVENNLGLLERLWLENDFLVGKNLTMADILGSSEINQLRLCQYRVDE 188
Fly 189 KKFPKVVKW--------LERVRV 203 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
GstT2 | NP_724816.3 | GST_N_Theta | 5..80 | CDD:239348 | 12/65 (18%) |
GstA | 7..202 | CDD:223698 | 37/215 (17%) | ||
GST_C_family | 93..218 | CDD:295467 | 25/135 (19%) | ||
Mars1 | NP_001165053.1 | Thioredoxin_like | 1..68 | CDD:294274 | |
GstA | <47..189 | CDD:223698 | |||
GST_C_MetRS_N | 77..179 | CDD:198340 | |||
PRK12268 | 266..821 | CDD:237029 | 39/218 (18%) | ||
MetRS_core | 267..635 | CDD:173907 | 24/141 (17%) | ||
'HIGH' region | 275..285 | ||||
'KMSKS' region | 595..599 | 0/3 (0%) | |||
Anticodon_Ia_Met | 644..773 | CDD:153411 | 15/67 (22%) | ||
MetRS_RNA | 855..899 | CDD:238475 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0625 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |