DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT2 and Mars1

DIOPT Version :9

Sequence 1:NP_724816.3 Gene:GstT2 / 246386 FlyBaseID:FBgn0050005 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_001165053.1 Gene:Mars1 / 216443 MGIID:1345633 Length:910 Species:Mus musculus


Alignment Length:218 Identity:39/218 - (17%)
Similarity:75/218 - (34%) Gaps:68/218 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 PIALRKFE-------------------QLTDEYKKINRFQKVPAIVGGDFHLSETIAIIRYLA-D 78
            |:.|..||                   ..||:::|   :.|.|          |.:.:.:::| |
Mouse   506 PVPLEGFEDKVFYVWFDATIGYVSITANYTDQWEK---WWKNP----------EQVDLYQFMAKD 557

  Fly    79 KGQFDEKLYPKTL----ENRARVDEFLEWQHLNIRLACSMYFR----------------DAWLFP 123
            ...|...::|.::    :|...|...:..::||.........|                |.|.|.
Mouse   558 NVPFHGLVFPCSVLGAEDNYTLVKHIIATEYLNYEDGKFSKSRGIGVFGDMAKDTGIPADIWRFY 622

  Fly   124 MNGIAPKPKPEQIQALIEGVENNLGLLERLWLENDFLVGKNLTMADILGSSEINQLRLCQYRVDE 188
            :..|.|:.:..........::||..||..|   .:|:....:.::...|.. :.::.|..   |:
Mouse   623 LLYIRPEGQDSAFSWTDLLIKNNSELLNNL---GNFINRAGMFVSKFFGGC-VPEMALTP---DD 680

  Fly   189 KKFPKVVKW--------LERVRV 203
            ::....|.|        ||:||:
Mouse   681 RRLVAHVSWELQHYHQLLEKVRI 703

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT2NP_724816.3 GST_N_Theta 5..80 CDD:239348 12/65 (18%)
GstA 7..202 CDD:223698 37/215 (17%)
GST_C_family 93..218 CDD:295467 25/135 (19%)
Mars1NP_001165053.1 Thioredoxin_like 1..68 CDD:294274
GstA <47..189 CDD:223698
GST_C_MetRS_N 77..179 CDD:198340
PRK12268 266..821 CDD:237029 39/218 (18%)
MetRS_core 267..635 CDD:173907 24/141 (17%)
'HIGH' region 275..285
'KMSKS' region 595..599 0/3 (0%)
Anticodon_Ia_Met 644..773 CDD:153411 15/67 (22%)
MetRS_RNA 855..899 CDD:238475
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.