DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT2 and Clic6

DIOPT Version :9

Sequence 1:NP_724816.3 Gene:GstT2 / 246386 FlyBaseID:FBgn0050005 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_766057.1 Gene:Clic6 / 209195 MGIID:2146607 Length:596 Species:Mus musculus


Alignment Length:231 Identity:48/231 - (20%)
Similarity:81/231 - (35%) Gaps:79/231 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 GDFHLSETIAIIRYLADKG------QFDEKLYPKTLENRA-------------------RVDEFL 101
            |:...|:.:.:|.:|  ||      ..|.|..|..|:|.|                   :::|||
Mouse   377 GNCPFSQRLFMILWL--KGVIFNVTTVDLKRKPADLQNLAPGTNPPFMTFDGEVKTDVNKIEEFL 439

  Fly   102 E------------WQHLNIRLACSMYF-----------RDA----------WLFPMNGIAPKPKP 133
            |            .||.....|.:..|           :||          .|..::.....|.|
Mouse   440 EEKLVPPRYPKLGTQHPESNSAGNDVFAKFSAFIKNTKKDANEIYEKNLLRALKKLDSYLNSPLP 504

  Fly   134 EQIQALIEGVENNLGLLERLWLENDFLVGKNLTMADILGSSEINQLRLCQYRVDEKKFPKVVK-- 196
            ::|.|   ....::.:.:|     .||.|..||:||.....:::.:::...:..:.:||..:.  
Mouse   505 DEIDA---DSSEDVTVSQR-----KFLDGDELTLADCNLLPKLHIIKIVAKKYRDFEFPSEMTGI 561

  Fly   197 WLERVRVSANPYHDEGLTF---IDRKSKQ--STAAK 227
            |    |...|.|..:..|.   .||:.:.  |.|||
Mouse   562 W----RYLNNAYARDEFTNTCPADREIEHAYSDAAK 593

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT2NP_724816.3 GST_N_Theta 5..80 CDD:239348 4/17 (24%)
GstA 7..202 CDD:223698 38/199 (19%)
GST_C_family 93..218 CDD:295467 32/181 (18%)
Clic6NP_766057.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..360
PHA02664 <69..167 CDD:177447
GST_N_CLIC 360..448 CDD:239359 16/72 (22%)
O-ClC 363..596 CDD:129941 48/231 (21%)
GST_C_CLIC6 455..594 CDD:198334 31/151 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167844580
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.