Sequence 1: | NP_724816.3 | Gene: | GstT2 / 246386 | FlyBaseID: | FBgn0050005 | Length: | 228 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_766057.1 | Gene: | Clic6 / 209195 | MGIID: | 2146607 | Length: | 596 | Species: | Mus musculus |
Alignment Length: | 231 | Identity: | 48/231 - (20%) |
---|---|---|---|
Similarity: | 81/231 - (35%) | Gaps: | 79/231 - (34%) |
- Green bases have known domain annotations that are detailed below.
Fly 62 GDFHLSETIAIIRYLADKG------QFDEKLYPKTLENRA-------------------RVDEFL 101
Fly 102 E------------WQHLNIRLACSMYF-----------RDA----------WLFPMNGIAPKPKP 133
Fly 134 EQIQALIEGVENNLGLLERLWLENDFLVGKNLTMADILGSSEINQLRLCQYRVDEKKFPKVVK-- 196
Fly 197 WLERVRVSANPYHDEGLTF---IDRKSKQ--STAAK 227 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
GstT2 | NP_724816.3 | GST_N_Theta | 5..80 | CDD:239348 | 4/17 (24%) |
GstA | 7..202 | CDD:223698 | 38/199 (19%) | ||
GST_C_family | 93..218 | CDD:295467 | 32/181 (18%) | ||
Clic6 | NP_766057.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..360 | ||
PHA02664 | <69..167 | CDD:177447 | |||
GST_N_CLIC | 360..448 | CDD:239359 | 16/72 (22%) | ||
O-ClC | 363..596 | CDD:129941 | 48/231 (21%) | ||
GST_C_CLIC6 | 455..594 | CDD:198334 | 31/151 (21%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C167844580 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |