DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT2 and eef1g

DIOPT Version :9

Sequence 1:NP_724816.3 Gene:GstT2 / 246386 FlyBaseID:FBgn0050005 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_775370.1 Gene:eef1g / 195822 ZFINID:ZDB-GENE-020423-3 Length:442 Species:Danio rerio


Alignment Length:190 Identity:52/190 - (27%)
Similarity:79/190 - (41%) Gaps:43/190 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 LKFSNSPVEYCPIALRKFEQLTDEYKKINRFQ--KVPAIVGGD-FHLSETIAIIRYLADKGQFDE 84
            ||.:::|..:      .|.|.......:..|.  ||||..|.| |.|.|:.||..||:     ::
Zfish    29 LKIASAPPAF------TFGQTNRSPAFLGNFPLGKVPAYQGDDGFCLFESNAIAHYLS-----ND 82

  Fly    85 KLYPKTLENRARVDEFLEWQHLNIRLACSMYFRD--------AWLFPMNGIAPKPKPEQIQALIE 141
            .|...|.:..|:|   |:|          :.|.|        ||:||..||....|....||. |
Zfish    83 VLRGSTPQASAQV---LQW----------VSFADSEVIPPASAWVFPTLGIMQFNKQATEQAK-E 133

  Fly   142 GVENNLGLLERLWLENDFLVGKNLTMADILGSSEI----NQLRLCQYRVDEKKFPKVVKW 197
            .|:..|.:|.:......||||:.:::|||.....:    .|:....:|   :.:|.|.:|
Zfish   134 EVKRVLAVLNQHLNTRTFLVGERISLADITVVCSLLWLYKQVLELAFR---QPYPNVTRW 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT2NP_724816.3 GST_N_Theta 5..80 CDD:239348 19/59 (32%)
GstA 7..202 CDD:223698 52/190 (27%)
GST_C_family 93..218 CDD:295467 31/117 (26%)
eef1gNP_775370.1 GST_N_EF1Bgamma 4..82 CDD:239342 19/63 (30%)
maiA 5..201 CDD:273527 52/190 (27%)
GST_C_EF1Bgamma_like 91..213 CDD:198290 31/117 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 227..273
EF1G 280..386 CDD:279041
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.