DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT2 and gst-21

DIOPT Version :9

Sequence 1:NP_724816.3 Gene:GstT2 / 246386 FlyBaseID:FBgn0050005 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_001256002.1 Gene:gst-21 / 191412 WormBaseID:WBGene00001769 Length:231 Species:Caenorhabditis elegans


Alignment Length:193 Identity:52/193 - (26%)
Similarity:85/193 - (44%) Gaps:43/193 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSKPIRFYYDLLSPIARGLWIGLKFSNS--PVEYCPIALRKFEQLTDEYKKINRFQKVPAIVGGD 63
            :::|.|..:.|      |   |:.|.:|  ||: ....|....:|.|..||. .|.|.|.:...|
 Worm    26 LAEPARMLFHL------G---GVPFEDSRIPVD-MKTGLIMNPELADVKKKA-PFGKYPVLKIDD 79

  Fly    64 FHLSETIAIIRYLADKGQFDEKLYPKTLENRARVDEFLEWQHLNIRLACSMY---FRDAWLFPMN 125
            ..::::.||.||||.:..|..|   ..:| .|:.|.:::        .|..|   ||......:.
 Worm    80 IEIAQSAAINRYLARQFGFAGK---NPIE-EAQADSYID--------QCQEYNTSFRACMYATLQ 132

  Fly   126 GIAPKPKPEQIQALIEGV----ENNL-----GLLERLWLENDFLVGKNLTMADILGSSEINQL 179
            |   ||: |::|.:.|.|    :|..     .:|.|  .::.||||.:||.||::.:..:..|
 Worm   133 G---KPE-EEVQKIREEVYIPAQNKFYEIFSDILNR--NKSGFLVGDSLTWADLVIADHLYSL 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT2NP_724816.3 GST_N_Theta 5..80 CDD:239348 23/76 (30%)
GstA 7..202 CDD:223698 50/187 (27%)
GST_C_family 93..218 CDD:295467 25/99 (25%)
gst-21NP_001256002.1 GST_N_Sigma_like 16..94 CDD:239337 23/78 (29%)
PTZ00057 18..231 CDD:173353 52/193 (27%)
GST_C_Sigma_like 104..213 CDD:198301 26/101 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.