DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT2 and gst-30

DIOPT Version :10

Sequence 1:NP_724816.3 Gene:GstT2 / 246386 FlyBaseID:FBgn0050005 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_494902.1 Gene:gst-30 / 191347 WormBaseID:WBGene00001778 Length:213 Species:Caenorhabditis elegans


Alignment Length:62 Identity:15/62 - (24%)
Similarity:25/62 - (40%) Gaps:23/62 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   159 FLVGKNLTMADIL------------GS---------SEINQLRLCQYRVDEKKFPKVVKWLE 199
            ||:|.::|..|:|            ||         .|..:|:..|.::  ...|.:.||:|
 Worm   147 FLIGDSVTWVDLLIAQHTSDLLSDSGSVFAASQSLLDEFPELKAHQKKI--HSIPNIKKWVE 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT2NP_724816.3 GST_N_Theta 5..80 CDD:239348
GST_C_family 93..218 CDD:470672 15/62 (24%)
gst-30NP_494902.1 GST_N_Sigma_like 4..73 CDD:239337
GST_C_Sigma_like 83..195 CDD:198301 11/47 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.