DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT2 and Y53G8B.1

DIOPT Version :9

Sequence 1:NP_724816.3 Gene:GstT2 / 246386 FlyBaseID:FBgn0050005 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_497662.1 Gene:Y53G8B.1 / 190243 WormBaseID:WBGene00021817 Length:213 Species:Caenorhabditis elegans


Alignment Length:212 Identity:58/212 - (27%)
Similarity:87/212 - (41%) Gaps:43/212 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SKPIRFYYDLLSPIARGLWIGLKFSNSPVEYCPIALRKFEQLTDEYKKINRFQKVPAIVGGDFHL 66
            :||| .|....|..:..:...|.......||.|:.|.. :|...|:...|..:|||.:......|
 Worm     3 AKPI-LYSSWSSGCSSRVRTALALKKIDYEYQPVNLLN-KQKEQEFHGNNPAEKVPILKINGLTL 65

  Fly    67 SETIAIIRYLADKGQFDEKLYPKTLENRARVDEFLEWQHLNIRLACSMYFRDAWLFPMNGIAP-K 130
            :|::|||.|| |:...|..|.||..|.:||              |.::.|..|     :.|.| :
 Worm    66 TESMAIIEYL-DEIYPDPPLLPKEPELKAR--------------ARAIAFHIA-----SNIQPLQ 110

  Fly   131 PKPEQIQALIEGVENNLG--------------LLERLWLEN-DFLVGKNLTMADI-LGSSEINQL 179
            .||  |..::...|...|              |.|.|.:.: ||.||..:::||| |.|...|.:
 Worm   111 NKP--IYLMLNEKEPGYGDFWCQHFISKGFKALEELLQMHSGDFCVGNQISIADICLPSIVYNAI 173

  Fly   180 RLCQYRVDEKKFPKVVK 196
            .  :|.||...:|.:.:
 Worm   174 E--KYHVDMTPYPIITR 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT2NP_724816.3 GST_N_Theta 5..80 CDD:239348 22/74 (30%)
GstA 7..202 CDD:223698 55/207 (27%)
GST_C_family 93..218 CDD:295467 29/121 (24%)
Y53G8B.1NP_497662.1 Thioredoxin_like 5..76 CDD:294274 22/73 (30%)
maiA 18..211 CDD:273527 53/196 (27%)
GST_C_Zeta 89..207 CDD:198300 30/123 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160163404
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.