DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT2 and gst-24

DIOPT Version :9

Sequence 1:NP_724816.3 Gene:GstT2 / 246386 FlyBaseID:FBgn0050005 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_496859.1 Gene:gst-24 / 185407 WormBaseID:WBGene00001772 Length:209 Species:Caenorhabditis elegans


Alignment Length:220 Identity:50/220 - (22%)
Similarity:91/220 - (41%) Gaps:61/220 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 FYYDL---LSPIARGLWIGLKFSNSPVEYCPIALRKFEQLTDEY---KKINRFQKVPAIVGGDFH 65
            :|::|   ..| ||.|     |..:.||:..:   :.|..|.|:   |....|.::|.:....|.
 Worm     7 YYFNLRGWAEP-ARQL-----FKLAHVEFEDV---RIENGTPEWGALKPKTPFGQLPFLSVDGFE 62

  Fly    66 LSETIAIIRYLADKGQFDEKLYPKTLENRARVDEFLEWQHLNIRLACSMYFRDAWLFPMNGIAPK 130
            :.::.||:||||.|..:    ..||.|..|.||..::            .|:| ::.|:..:...
 Worm    63 IPQSAAILRYLAKKFGY----AGKTSEEEAWVDAIVD------------QFKD-FVTPLRQLIMA 110

  Fly   131 PKPEQIQALIEGVENNL-------------GLLERLWLENDFLVGKNLT-----MADILGSSEI- 176
            .:....:. ||.::..:             |:||:  .::.||||..:|     :||||.:.|: 
 Worm   111 QRSGNAEE-IERIQKEVFAPARDTFFKILNGILEK--SKSGFLVGDGVTWADLVIADILTTMEML 172

  Fly   177 -------NQLRLCQYRVDEKKFPKV 194
                   .:.:|...|....:.|::
 Worm   173 GVFDKHGEEQKLAALREKVNEIPEI 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT2NP_724816.3 GST_N_Theta 5..80 CDD:239348 22/78 (28%)
GstA 7..202 CDD:223698 50/220 (23%)
GST_C_family 93..218 CDD:295467 24/128 (19%)
gst-24NP_496859.1 GST_N_Sigma_like 4..75 CDD:239337 21/76 (28%)
PTZ00057 6..208 CDD:173353 50/220 (23%)
GST_C_Sigma_like 85..191 CDD:198301 24/121 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.