Sequence 1: | NP_724816.3 | Gene: | GstT2 / 246386 | FlyBaseID: | FBgn0050005 | Length: | 228 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_496859.1 | Gene: | gst-24 / 185407 | WormBaseID: | WBGene00001772 | Length: | 209 | Species: | Caenorhabditis elegans |
Alignment Length: | 220 | Identity: | 50/220 - (22%) |
---|---|---|---|
Similarity: | 91/220 - (41%) | Gaps: | 61/220 - (27%) |
- Green bases have known domain annotations that are detailed below.
Fly 7 FYYDL---LSPIARGLWIGLKFSNSPVEYCPIALRKFEQLTDEY---KKINRFQKVPAIVGGDFH 65
Fly 66 LSETIAIIRYLADKGQFDEKLYPKTLENRARVDEFLEWQHLNIRLACSMYFRDAWLFPMNGIAPK 130
Fly 131 PKPEQIQALIEGVENNL-------------GLLERLWLENDFLVGKNLT-----MADILGSSEI- 176
Fly 177 -------NQLRLCQYRVDEKKFPKV 194 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
GstT2 | NP_724816.3 | GST_N_Theta | 5..80 | CDD:239348 | 22/78 (28%) |
GstA | 7..202 | CDD:223698 | 50/220 (23%) | ||
GST_C_family | 93..218 | CDD:295467 | 24/128 (19%) | ||
gst-24 | NP_496859.1 | GST_N_Sigma_like | 4..75 | CDD:239337 | 21/76 (28%) |
PTZ00057 | 6..208 | CDD:173353 | 50/220 (23%) | ||
GST_C_Sigma_like | 85..191 | CDD:198301 | 24/121 (20%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1231780at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 1 | 1.000 | - | - | X30 | |
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.920 |