DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT2 and exl-1

DIOPT Version :9

Sequence 1:NP_724816.3 Gene:GstT2 / 246386 FlyBaseID:FBgn0050005 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_497000.1 Gene:exl-1 / 175100 WormBaseID:WBGene00001371 Length:238 Species:Caenorhabditis elegans


Alignment Length:242 Identity:45/242 - (18%)
Similarity:82/242 - (33%) Gaps:68/242 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 PIARGLWIGLKF--SNSPVEYCPIALRKFEQLTDEYKK--INRFQKVPAIVGGDFHLSET----I 70
            |.|..|::...:  .:.|.....:......:.:.|:|.  :.|...:.|...|:....||    :
 Worm    21 PYAHHLFMRCLYHAKHDPTMKFDVKTTNVNKTSQEFKNTGLRRMPGISAEESGETQTFETEDDIL 85

  Fly    71 AIIRYLADKGQFDEKLYPKTLENRARVDEFLEWQHLNIRLACSMYFRDAWLFPMNGIAPKPKPEQ 135
            ..:.||..:...||:     .||                ..|.::                  .|
 Worm    86 DFLEYLKPERGDDEE-----AEN----------------ATCDLF------------------RQ 111

  Fly   136 IQALIEGVEN-----NLGLLERL--WL---ENDFLVGKNLTMADILGSSEINQLRLCQYRVDEKK 190
            ....::.||:     |..|| ||  :|   |..||:..::|..|.|..:.::.:|:....:...:
 Worm   112 FARFVKDVEHRDTAFNTELL-RLDKYLSEQETKFLISDDVTHIDCLVLTRLHSIRVAAKMLKNYE 175

  Fly   191 FP----KVVKWL------ERVRVSANPYHDEGLTFIDRKSKQSTAAK 227
            .|    .|:.:|      |..|||.....:..|.:.:.|.....:||
 Worm   176 IPADLSHVLDYLKAGYATEMFRVSCPSDQEIVLHWTELKDTPRLSAK 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT2NP_724816.3 GST_N_Theta 5..80 CDD:239348 13/73 (18%)
GstA 7..202 CDD:223698 38/215 (18%)
GST_C_family 93..218 CDD:295467 26/144 (18%)
exl-1NP_497000.1 O-ClC 2..213 CDD:129941 42/231 (18%)
GST_C_family 98..210 CDD:295467 29/151 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160163409
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.