DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT2 and Gstm3

DIOPT Version :9

Sequence 1:NP_724816.3 Gene:GstT2 / 246386 FlyBaseID:FBgn0050005 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_034489.1 Gene:Gstm3 / 14864 MGIID:106026 Length:218 Species:Mus musculus


Alignment Length:241 Identity:60/241 - (24%)
Similarity:97/241 - (40%) Gaps:72/241 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 PIARGLW----------IGLKFSNSPVE---YCPIALRKFEQ---LTDEYKKINRFQKVPAIVGG 62
            |:..|.|          :.|::::|..|   |.......|::   |::::.....|..:|.::.|
Mouse     2 PMTLGYWNTRGLTHSIRLLLEYTDSSYEEKRYVMGDAPNFDRSQWLSEKFNLGLDFPNLPYLIDG 66

  Fly    63 DFHLSETIAIIRYLADKGQFDEKLYPKTLENRARVDEFLEWQHLNIRL-----ACSMYFRDAWLF 122
            ...::::.||:|||..|    ..|..:|.|.|.|||. ||.|.::.|:     .||..|.     
Mouse    67 SHKVTQSNAILRYLGRK----HNLCGETEEERIRVDT-LENQVMDTRIQLMIVCCSPDFE----- 121

  Fly   123 PMNGIAPKPKPEQIQALIEGVENNLGLLERLWLENDFL------VGKNLTMADILGSSEINQLRL 181
                   |.|||.::|          :.|::.|.::||      .|..:|..|.|....::    
Mouse   122 -------KQKPEFLKA----------IPEKMKLYSEFLGKRPWFAGDKVTYVDFLAYDILD---- 165

  Fly   182 CQYRVDEKK----FPKVVKWLERVRVSANPYHDEGLTFIDRKSKQS 223
             |||:.|.|    ||.:..:|.|.         |||..|....|.|
Mouse   166 -QYRMFEPKCLDAFPNLRDFLARF---------EGLKKISAYMKSS 201

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstT2NP_724816.3 GST_N_Theta 5..80 CDD:239348 17/81 (21%)
GstA 7..202 CDD:223698 54/218 (25%)
GST_C_family 93..218 CDD:295467 37/139 (27%)
Gstm3NP_034489.1 GstA 3..189 CDD:223698 53/226 (23%)
GST_N_Mu 3..84 CDD:239373 17/84 (20%)