DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT2 and GSTO2

DIOPT Version :9

Sequence 1:NP_724816.3 Gene:GstT2 / 246386 FlyBaseID:FBgn0050005 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_899062.1 Gene:GSTO2 / 119391 HGNCID:23064 Length:243 Species:Homo sapiens


Alignment Length:211 Identity:47/211 - (22%)
Similarity:71/211 - (33%) Gaps:62/211 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 PIARGLWIGLKFSNSPVEYCPIALR-----KFEQLTDEYKKIN------------RFQKVPAIVG 61
            |:..||   ::..:  :.:||.:.|     |.:.:..|...||            .|..:|.:..
Human    18 PVPEGL---IRIYS--MRFCPYSHRTRLVLKAKDIRHEVVNINLRNKPEWYYTKHPFGHIPVLET 77

  Fly    62 GDFHL-SETIAIIRYLADKGQFDEKLYPKTLENRARVDEFLEWQHLNIRLACSMYFRDAWLFPMN 125
            ....| .|::....|| |......||:|.....|||       |.:.:.|.|.:           
Human    78 SQCQLIYESVIACEYL-DDAYPGRKLFPYDPYERAR-------QKMLLELFCKV----------- 123

  Fly   126 GIAPKPKPEQIQALIEGVE-NNLGLLERLWLEN--DFLVGKNLTMADILGSSEINQLRLCQYRVD 187
               |....|.:.||..|.| .||....|....|  :.|..:|.|   ..|.:       |...:|
Human   124 ---PHLTKECLVALRCGRECTNLKAALRQEFSNLEEILEYQNTT---FFGGT-------CISMID 175

  Fly   188 EKKFPKVVKWLERVRV 203
            ...:|    |.||:.|
Human   176 YLLWP----WFERLDV 187

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstT2NP_724816.3 GST_N_Theta 5..80 CDD:239348 17/83 (20%)
GstA 7..202 CDD:223698 46/208 (22%)
GST_C_family 93..218 CDD:295467 27/114 (24%)
GSTO2NP_899062.1 Thioredoxin_like 7..94 CDD:320948 16/81 (20%)