DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT2 and CLIC2

DIOPT Version :9

Sequence 1:NP_724816.3 Gene:GstT2 / 246386 FlyBaseID:FBgn0050005 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_001280.3 Gene:CLIC2 / 1193 HGNCID:2063 Length:247 Species:Homo sapiens


Alignment Length:214 Identity:47/214 - (21%)
Similarity:79/214 - (36%) Gaps:73/214 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 LWI-GLKFSNSPVEYCPIALRKFEQLTD-------EYKKINRFQKVPAIVGGDFHLSETIAIIRY 75
            ||: |:||:.:.|:    ..||.|:|.|       .:...|:..|...|...:| |.:|:|..||
Human    40 LWLKGVKFNVTTVD----MTRKPEELKDLAPGTNPPFLVYNKELKTDFIKIEEF-LEQTLAPPRY 99

  Fly    76 LADKGQFDEKLYPKTLENRARVDEFLEWQHLNIRLACSMYFR-DAWLFPMNGIAPKPKPEQIQAL 139
                    ..|.||..|              :..:.|:::.: .|::......|.|...:.:...
Human   100 --------PHLSPKYKE--------------SFDVGCNLFAKFSAYIKNTQKEANKNFEKSLLKE 142

  Fly   140 IEGVEN--NLGLLERLWLEND-----------FLVGKNLTMADILGSSEINQLRLCQYRVDEKKF 191
            .:.:::  |..||:.  ::.|           ||.|..||:||            |..      .
Human   143 FKRLDDYLNTPLLDE--IDPDSAEEPPVSRRLFLDGDQLTLAD------------CSL------L 187

  Fly   192 PKVVKWLERVRVSANPYHD 210
            ||    |..::|:|..|.|
Human   188 PK----LNIIKVAAKKYRD 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT2NP_724816.3 GST_N_Theta 5..80 CDD:239348 20/68 (29%)
GstA 7..202 CDD:223698 43/204 (21%)
GST_C_family 93..218 CDD:295467 23/132 (17%)
CLIC2NP_001280.3 Required for insertion into the membrane. /evidence=ECO:0000250 1..96 17/60 (28%)
N-terminal 1..94 16/58 (28%)
O-ClC 12..245 CDD:129941 47/214 (22%)
Joint loop 95..106 5/18 (28%)
C-terminal 107..247 24/134 (18%)
Foot loop 151..171 4/21 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154389
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.