DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT2 and eef1e1

DIOPT Version :9

Sequence 1:NP_724816.3 Gene:GstT2 / 246386 FlyBaseID:FBgn0050005 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_001107137.1 Gene:eef1e1 / 100038230 XenbaseID:XB-GENE-493638 Length:174 Species:Xenopus tropicalis


Alignment Length:149 Identity:37/149 - (24%)
Similarity:62/149 - (41%) Gaps:36/149 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 KVPAIVGGDFHLSETIAIIRYLADKGQFDEKLYPKTLENRARVDEFLEWQHLNIRLACSMYFRDA 119
            |.|::||    || |||  .:|..:.: .|:|...|.|.:|.|.::||::...|..|.|.     
 Frog    37 KGPSLVG----LS-TIA--SHLVKEAK-KEELLGSTAEEKAIVQQWLEYRISYIDRASSK----- 88

  Fly   120 WLFPMNGIAPKPKPEQIQALIEGVENNLGLLERLWLENDFLVGKNLTMADILGSSEINQLRLCQY 184
                                 |.:.|.|..|.....:..|:.|..:|:||||....::.: :...
 Frog    89 ---------------------EDIRNVLNDLNHYLKDKVFVAGNTVTLADILIYYGLHPV-ITGL 131

  Fly   185 RVDEKK-FPKVVKWLERVR 202
            .|.||: :..|.:|...::
 Frog   132 SVQEKETYINVSRWFSHIQ 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT2NP_724816.3 GST_N_Theta 5..80 CDD:239348 10/24 (42%)
GstA 7..202 CDD:223698 37/147 (25%)
GST_C_family 93..218 CDD:295467 23/111 (21%)
eef1e1NP_001107137.1 GST_C_AIMP3 65..165 CDD:198338 24/113 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.