DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30002 and CG9733

DIOPT Version :10

Sequence 1:NP_001163100.1 Gene:CG30002 / 246384 FlyBaseID:FBgn0260474 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_651784.2 Gene:CG9733 / 43601 FlyBaseID:FBgn0039759 Length:418 Species:Drosophila melanogaster


Alignment Length:285 Identity:89/285 - (31%)
Similarity:132/285 - (46%) Gaps:46/285 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 CGVRSNQIPAVRIRFMITGGRKSSLMSQPWMAFLHI----ASDLEMCRCGGSLISELFVLTAAHC 106
            ||       .|.||..|..|:.:.:...|||..|..    .:.|... |.||||:..:|||||||
  Fly   153 CG-------GVGIRNRIYDGQDTDVNEFPWMVLLEYRRRSGNGLSTA-CAGSLINRRYVLTAAHC 209

  Fly   107 FKMCPRSKE-----IRVWLGELDLSSTSDCTTYNYERVCAPPVEEFTIDKWILHEEFN--LFYPG 164
              :..|.:.     :.|.|||.|..:..||......  |:|.|:....::..:||.::  .....
  Fly   210 --LTGRIEREVGTLVSVRLGEHDTRTAVDCPPGGGS--CSPEVQRLGFEEIRVHERYSEKASNQV 270

  Fly   165 YDIALIKLNKKVVFKDHIRPICLPLTDELLAFTLQLGQRFMAVGWGKTESLRYANSTMEVDIRTE 229
            :||.||::.:.|.:.|:|:|||||.:..|  .:.|.||:|...|||:|  |:.|.|.::..:...
  Fly   271 HDIGLIRMERNVRYSDNIQPICLPSSVGL--ESRQSGQQFTVAGWGRT--LKMARSAVKQKVTVN 331

  Fly   230 -----KCTD-------GRDTSFLCASGDY-VDTCNGDSGGPLLWKTTLFGKDRAVQFGVVSTGSQ 281
                 ||..       ..:.:.|||.|.: .|:|:|||||||:    .|..:..|..|:||.| .
  Fly   332 YVDPAKCRQRFSQIKVNLEPTQLCAGGQFRKDSCDGDSGGPLM----RFRDESWVLEGIVSFG-Y 391

  Fly   282 NCG-AGHKAYYMDVPTYMPWILEKM 305
            .|| ......|.:|..|..||.:.:
  Fly   392 KCGLKDWPGVYTNVAAYDIWIRQNV 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30002NP_001163100.1 Tryp_SPc 62..301 CDD:238113 82/263 (31%)
CG9733NP_651784.2 CLIP 25..78 CDD:463440
Tryp_SPc 162..415 CDD:238113 84/266 (32%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.