DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30002 and CG9616

DIOPT Version :10

Sequence 1:NP_001163100.1 Gene:CG30002 / 246384 FlyBaseID:FBgn0260474 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_650347.2 Gene:CG9616 / 41731 FlyBaseID:FBgn0038214 Length:155 Species:Drosophila melanogaster


Alignment Length:67 Identity:16/67 - (23%)
Similarity:27/67 - (40%) Gaps:20/67 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   148 TIDKWILHEEF----NLF------YPGYDIALIKLNKKV---VFKDHI-------RPICLPLTDE 192
            |:..|:...|.    :||      ||..:.|.|.:.:.:   ||.:.:       :...|.|.|:
  Fly    56 TVLNWLATFEMQGKRDLFVGSMNTYPNKNEAAINIVRGMPAEVFVEFLNITNALPKLTSLYLNDQ 120

  Fly   193 LL 194
            ||
  Fly   121 LL 122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30002NP_001163100.1 Tryp_SPc 62..301 CDD:238113 16/67 (24%)
CG9616NP_650347.2 GD_N 24..133 CDD:464985 16/67 (24%)

Return to query results.
Submit another query.