DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30002 and Ser7

DIOPT Version :10

Sequence 1:NP_001163100.1 Gene:CG30002 / 246384 FlyBaseID:FBgn0260474 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster


Alignment Length:146 Identity:30/146 - (20%)
Similarity:47/146 - (32%) Gaps:55/146 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   309 MYKMGPAFSLNNETDIMAEIKDRGTVQAIMRVYRDFFSYRSGIYRHSAAATP------------- 360
            ||.....|:|..|.     :.|:|.          ...|..|||..:...||             
  Fly    33 MYWKEHCFALTAEL-----VVDKGM----------DLRYIGGIYAGNIKPTPFLCLALKMLQIQP 82

  Fly   361 ---------AEERSAYHSVRLIGWGEERVGYD---VVKYWIAI-NSWG--QWWGENGRF------ 404
                     .:|...|  :|.:|....|:.:|   :.||...: |.:.  ::..:.|||      
  Fly    83 DKDIVLEFIQQEEFKY--IRALGAMYLRLTFDSTEIYKYLEPLYNDFRKLRYMNKMGRFEAIYMD 145

  Fly   405 ----RILRGSNECDIE 416
                .:||....|||:
  Fly   146 DFIDNLLREDRYCDIQ 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30002NP_001163100.1 Tryp_SPc 62..301 CDD:238113
Ser7NP_572582.1 CLIP 29..74 CDD:197829 13/55 (24%)
Tryp_SPc 133..391 CDD:238113 8/29 (28%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.