DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Neto1 and Cubn

DIOPT Version :9

Sequence 1:NP_659195.3 Gene:Neto1 / 246317 MGIID:2180216 Length:533 Species:Mus musculus
Sequence 2:NP_727348.2 Gene:Cubn / 326235 FlyBaseID:FBgn0052702 Length:3750 Species:Drosophila melanogaster


Alignment Length:609 Identity:132/609 - (21%)
Similarity:205/609 - (33%) Gaps:219/609 - (35%)


- Green bases have known domain annotations that are detailed below.


Mouse    25 KGTEKQITPETQ----------------------------------KSVQCGTWTKHAEGGVFTS 55
            :|||.|.||..:                                  ....||: ..:|..|.|||
  Fly  1742 EGTEPQGTPRLKFCRSHPPALISNGQALTVSVPLQLVEEFQGHYMTMDTSCGS-IYNALSGKFTS 1805

Mouse    56 PNYPSKYPPDRECVYIIEAAPRQCIELYFDEKYSIEPSWECKFDHIEVRDGPFGFSPIIGRFCGQ 120
            |.||:.|||:.||::::||:....:.|.. |...:|.|..|..|::|||:.... ..:||.:||.
  Fly  1806 PYYPASYPPNIECLWLLEASMGNSLSLTL-ESMDLEKSESCNRDYLEVREESES-GQLIGVYCGN 1868

Mouse   121 QNPPVIKSSGRFLWIKFFADGELESMGFSARYNFTPDPDFKDLGVLKPLPACEFEMGGPEGIVES 185
            :.|.||.|.|. :|:||.:|.:....||.|.||:..                ..|:.|.||.:||
  Fly  1869 EVPGVIHSRGA-IWMKFKSDDDNVGEGFMASYNYEH----------------HNELNGTEGTIES 1916

Mouse   186 IQILKEGKASASEAVDCKWYIRAPPR-----SKIYLRFLDYEMQNSNECKRNFVAVYDGSSSVED 245
            ...    .:...:.|...|.|.....     |.:|||.||....|          .|||.|   |
  Fly  1917 PHF----PSKFQDPVPYSWRITVDKEYVVAISLLYLRDLDQPHLN----------FYDGYS---D 1964

Mouse   246 LKAKFCSTVANDVMLRTGLGVIRMWADEGSRNSRFQMLFTSFQEPPCEGNTFFCHSNMCIN-NTL 309
            :.|:...|..::.::                :|...:.|||.:.|            ..:| |.|
  Fly  1965 IGARIEVTDPDETII----------------SSTNVVYFTSNRGP------------FKLNWNRL 2001

Mouse   310 VCNGLQNCVYPWDENHCKEKRKTSLLDQLTNTSGTVIGVTS------------CIVIILIIVSVI 362
            ....|::       |...|:|.....:||.....:|||..|            |...::      
  Fly  2002 SKEALRS-------NRTAEERTRQCGNQLITIDRSVIGFHSPGYPNGYEQDLNCFWTLV------ 2053

Mouse   363 VQIKQPRKKYVQRKSDFDQTVFQEVFEPPHYELCTLRGTGATADFADV--AEDFENYHKLR---- 421
              ...|....|...|..|..:|.|               ...||:..:  ..|.:|:.:||    
  Fly  2054 --PSNPAMHAVLTLSQIDLEIFSE---------------DCIADYVKIFSGSDLQNWSELRTLCS 2101

Mouse   422 ---RSSSKCIHDH------------------------HCGSQLSSAKGSRSNLSTRDASILAEIP 459
               .||.:..|..                        .|||:::::|| ..|::    .||..:|
  Fly  2102 LPTESSDRVFHGRPYLRVEFVTDPSVNKTGFNGIVRTACGSEITASKG-LVNIT----EILKVLP 2161

Mouse   460 T--------------QPVKPLIPPV-----------NRRNILVMKHNYSQDA-----ADACDIDE 494
            .              :.:|...|..           :.||.|::::...:|:     ...|: |.
  Fly  2162 RPNHDCVWTIKVRQGRRIKIDFPDFQLQNNMASGSSDCRNYLLLRNGNDEDSPFLGRGKYCE-DV 2225

Mouse   495 IEEVPTTSHR---LSRHEKSVQRF 515
            :.||..||..   :..|..|..||
  Fly  2226 VHEVLNTSSNKAYIKFHFASPPRF 2249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Neto1NP_659195.3 CUB 51..154 CDD:238001 40/102 (39%)
CUB <200..286 CDD:238001 19/90 (21%)
LDLa 291..326 CDD:412164 5/35 (14%)
PDZ-binding 531..533
CubnNP_727348.2 EGF_CA 156..190 CDD:238011
EGF_CA 192..233 CDD:238011
EGF_CA 282..322 CDD:214542
EGF_3 328..366 CDD:289699
EGF 430..457 CDD:278437
EGF_CA 469..503 CDD:238011
CUB 509..622 CDD:238001
CUB 627..737 CDD:238001
CUB 744..849 CDD:294042
CUB 853..970 CDD:238001
CUB 978..1094 CDD:238001
CUB 1100..1211 CDD:238001
CUB 1216..1330 CDD:238001
CUB 1446..1549 CDD:238001
CUB 1554..1667 CDD:238001
CUB 1792..1899 CDD:238001 42/110 (38%)
CUB 1910..1998 CDD:294042 26/132 (20%)
CUB 2019..2133 CDD:238001 22/136 (16%)
CUB 2140..2242 CDD:238001 21/107 (20%)
CUB 2263..2379 CDD:238001
CUB 2385..2511 CDD:238001
CUB 2516..2630 CDD:238001
CUB <2833..2892 CDD:294042
CUB 2898..3008 CDD:238001
CUB 3011..3127 CDD:238001
CUB 3130..3241 CDD:238001
CUB 3254..3363 CDD:238001
CUB 3379..3508 CDD:238001
CUB 3531..3601 CDD:294042
CUB 3623..3733 CDD:238001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.