DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fgl1 and CG31832

DIOPT Version :9

Sequence 1:NP_742007.2 Gene:Fgl1 / 246186 RGDID:620169 Length:314 Species:Rattus norvegicus
Sequence 2:NP_723894.2 Gene:CG31832 / 318970 FlyBaseID:FBgn0051832 Length:227 Species:Drosophila melanogaster


Alignment Length:191 Identity:78/191 - (40%)
Similarity:110/191 - (57%) Gaps:22/191 - (11%)


- Green bases have known domain annotations that are detailed below.


  Rat   122 WTVIQRRSDGSENFNRGWNDYENGFGNFVQSNGEYWLGNKNINLLTMQGDYTLKIDLTDFEKNSR 186
            |.|||||.|||.|||:.|..|::|||:   .|||:::|.:.:.|:|.:..:.|.|.|......:.
  Fly    56 WIVIQRRLDGSVNFNQSWFSYKDGFGD---PNGEFFIGLQKLYLMTREQPHELFIQLKHGPGATV 117

  Rat   187 FAQYEKFKVGDEKSFYEL-NIGEYSGTAGDSLSGTFHPEVQWWASHQTMKFSTRDRDNDNYNGNC 250
            :|.::.|:|..|...|:| .:|:|||||||||           ..|...:|||.|||||..:.||
  Fly   118 YAHFDDFQVDSETELYKLERVGKYSGTAGDSL-----------RYHINKRFSTFDRDNDESSKNC 171

  Rat   251 AEEEQSGWWFNRCHSANLNGVYYQGPYRAETD--NGVVWYTWRGWWYSLKSVVMKIRPSDF 309
            |.|...||||:.|.|::|||:|::   ..||.  ||:.|..|:  :.||..|.:.|||..|
  Fly   172 AAEHGGGWWFHSCLSSSLNGLYFR---EGETGMLNGIHWGRWK--FQSLTFVQIMIRPKYF 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fgl1NP_742007.2 FReD 80..306 CDD:238040 75/186 (40%)
CG31832NP_723894.2 FReD 28..225 CDD:238040 76/187 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 163 1.000 Inparanoid score I4104
OMA 1 1.010 - - QHG48118
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X25
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.970

Return to query results.
Submit another query.