DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Serpine1 and Spn42Dd

DIOPT Version :9

Sequence 1:NP_036752.2 Gene:Serpine1 / 24617 RGDID:3249 Length:402 Species:Rattus norvegicus
Sequence 2:NP_001163067.1 Gene:Spn42Dd / 49808 FlyBaseID:FBgn0028988 Length:372 Species:Drosophila melanogaster


Alignment Length:366 Identity:110/366 - (30%)
Similarity:183/366 - (50%) Gaps:17/366 - (4%)


- Green bases have known domain annotations that are detailed below.


  Rat    41 KVFQHVVQASKDRNVVFSPYGVSSVLAMLQLTTAGKTRQQIQDAMGFNISERGTAPALR--KLSK 103
            :::|.:.::..::|:|.||..:.::|:|:.:...|.|.:::|.|:|.. ||...|.|.|  .|..
  Fly    20 EIYQLLSKSHTNQNLVVSPVSIETILSMVFMGAEGSTAKELQSALGLP-SEDKEAVAARYGALLN 83

  Rat   104 ELMGSWNKNEISTADAIFVQRDLELVQGFMPHFFKLFRTTVKQVDFSEMERARFIINDWVERHTK 168
            :|.|......:..|:.|:|.....|.|.:.....:.|::..:.:..:....|...||.||...|.
  Fly    84 DLQGQEEGPILKLANRIYVNDQYSLNQNYNLAVREPFKSEAESISLTNGPVAAERINQWVLDQTS 148

  Rat   169 GMISDLLAKGAVNELTRLVLVNALYFNGQWKTPFLEASTHQRLFHKSDGSTISVPMMAQNNKFNY 233
            |.|..::..|::....:.:||||:||.|||::.|..|.|....|..:...::.|.||||...|..
  Fly   149 GKIKGMIDPGSMTSDVKALLVNAIYFKGQWESKFDPAKTRASTFQVTANKSVPVQMMAQMGTFRA 213

  Rat   234 TEFTTPDGHEYDILELPYHGETLSMFIAAPFEKDVPLSAITNILDAELIRQWKSNMTRLPRLLIL 298
            ..|...|.   .::||||....|||.|..|.|.: .|||:     .|.|..:...:......|.|
  Fly   214 NYFRDLDA---QVIELPYLNSNLSMTIFLPREVE-GLSAL-----EEKIVGFARPLVAKEVYLKL 269

  Rat   299 PKFSLETEVDLRGPLEKLGMTDIFSSTQADFTSL-SDQEQLSVAQALQKVKIEVNESGTVASSST 362
            |||.:|...:|:..|||||:.::|:. ::|.:.| :|:....|:|...|..:||||.|..|:.:|
  Fly   270 PKFKIEFRDELKETLEKLGIRELFTD-KSDLSGLFADKSGGKVSQVSHKAFLEVNEEGAEAAGAT 333

  Rat   363 AILVSARMA-PTEMVLDRSFLFVVRHNPTETILFMGQLMEP 402
            ::.|:.|.. .|.::.|..|.||:|  ...||.|.|:::.|
  Fly   334 SVAVTNRAGFSTFLMADHPFAFVIR--DANTIYFQGRVVSP 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Serpine1NP_036752.2 serpin 29..402 CDD:422956 109/364 (30%)
Spn42DdNP_001163067.1 SERPIN 16..369 CDD:238101 109/361 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.