DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Oprd1 and AstC-R1

DIOPT Version :9

Sequence 1:NP_036749.1 Gene:Oprd1 / 24613 RGDID:3233 Length:372 Species:Rattus norvegicus
Sequence 2:NP_649040.2 Gene:AstC-R1 / 40020 FlyBaseID:FBgn0036790 Length:483 Species:Drosophila melanogaster


Alignment Length:336 Identity:114/336 - (33%)
Similarity:179/336 - (53%) Gaps:33/336 - (9%)


- Green bases have known domain annotations that are detailed below.


  Rat    55 LYSAVCAVGLLGNVLVMFGIVRYTKLKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGEL 119
            ||..||.:||.||.||::.::|::|::|.|||||.|||:||......:||......:.:|.|||.
  Fly    83 LYGFVCIIGLFGNTLVIYVVLRFSKMQTVTNIYILNLAVADECFLIGIPFLLYTMRICSWRFGEF 147

  Rat   120 LCKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVGVPIM 184
            :|||.:.......|||...|.:||.|||||||||:.:..:||...||:::...|..::.:.:|::
  Fly   148 MCKAYMVSTSITSFTSSIFLLIMSADRYIAVCHPISSPRYRTLHIAKVVSAIAWSTSAVLMLPVI 212

  Rat   185 VMAVTQPRDGAV--VCTLQFPSP-SWYWDTVTKICVFLFAFVVPILIITVCYGLMLLRLRSVRLL 246
            :.|.|..::..:  .|.:.:|.. ..:..|...:..|...|..|:..|...|.|::.:||||...
  Fly   213 LYASTVEQEDGINYSCNIMWPDAYKKHSGTTFILYTFFLGFATPLCFILSFYYLVIRKLRSVGPK 277

  Rat   247 SG--SKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLV-------DINRRDPLVVAALHL 302
            .|  ||||.|:.|::||:||.|:..:::||.|..|..:  .|:       |::|.:.|:...|. 
  Fly   278 PGTKSKEKRRAHRKVTRLVLTVISVYILCWLPHWISQV--ALIHSNPAQRDLSRLEILIFLLLG- 339

  Rat   303 CIALGYANSSLNPVLYAFLDENFKRCF-------------RQLCRAPCGGQEPGSLRR---PRQA 351
              ||.|:||::||:|||||.|||::.|             .||...|....:.||.:|   .|..
  Fly   340 --ALVYSNSAVNPILYAFLSENFRKSFFKAFTCMNKQDINAQLQLEPSVFTKQGSKKRGGSKRLL 402

  Rat   352 TARERVTACTP 362
            |:..::....|
  Fly   403 TSNPQIPPLLP 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Oprd1NP_036749.1 7tm_4 59..>232 CDD:304433 60/175 (34%)
7tm_1 66..318 CDD:278431 90/263 (34%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 340..372 6/26 (23%)
AstC-R1NP_649040.2 7tm_4 88..368 CDD:304433 102/284 (36%)
7tm_1 94..353 CDD:278431 90/263 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24229
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X22
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
55.010

Return to query results.
Submit another query.