DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cpa5 and CG32379

DIOPT Version :9

Sequence 1:NP_954965.1 Gene:cpa5 / 246092 ZFINID:ZDB-GENE-020514-1 Length:419 Species:Danio rerio
Sequence 2:NP_729252.2 Gene:CG32379 / 326211 FlyBaseID:FBgn0052379 Length:344 Species:Drosophila melanogaster


Alignment Length:341 Identity:103/341 - (30%)
Similarity:178/341 - (52%) Gaps:27/341 - (7%)


- Green bases have known domain annotations that are detailed below.


Zfish    85 IPYHIMIENVQELLDDEQRDMVKYRGLARSTDDFVYTTYHDLNSINSFMDMLVAENRNMVSKVVI 149
            :.|.::||::..|:..::.:.::.:.|.:.....|.:.::..:.||.::|.|:......|.....
  Fly     6 LEYKVLIEDLAPLVHAQRAENLRKKLLIQWPHIDVLSAFYTHSEINDYLDSLLERFPKRVQVKQF 70

Zfish   150 GQSYEKRPLNVLKFSTG---ANRPGIWIDTGIHSREWVTQASGVWFAKKIVKDYGRDPVLTDILN 211
            |.|||:|||.||..:.|   .|:|.|.||..:|:|||::.:..::..::::.:||.:   .::|.
  Fly    71 GWSYERRPLKVLTITNGDGRRNKPVILIDGTVHAREWISPSMALYIIQQLLDNYGDN---QELLQ 132

Zfish   212 SHDIFLEIVTNPDGFVYTHTKDRMWRKTRKPNPGSSCVGVDPNRNWDAGFGGG---GSSNNPCTE 273
            .:|..:..|.|.||:.||||..|.|||:|:|.....|:|.|.|||:  |:..|   |||::||..
  Fly   133 DYDWVIMPVVNADGYEYTHTDSRYWRKSRRPTSNPECIGTDINRNF--GYEWGHDEGSSSDPCEN 195

Zfish   274 TYRGPSAHSEPEVKAIVDFVKSH-GKIKAFVSIHSYSQMLLYPYGYTY---TAAKDKAELHEVAR 334
            .|||.....:.|.:.:.|.:..: |::..::|:|||....|.|:|||.   ...:|...:.:...
  Fly   196 IYRGERPFDQSESQVLRDVMLHYKGRLNFYLSLHSYGNYFLLPWGYTSDFPDTYQDMMSVADAGA 260

Zfish   335 KAITSLQSLYNTR--YTYGSIITTIYQASGGTIDWTYNQGI---KYSYTFELRDTGRYGFILPAN 394
            |||     :|:|.  |:|||....:|..||.|.|:.:  |:   ..:.|.||...|..||....:
  Fly   261 KAI-----IYSTNGIYSYGSTYYVLYPTSGDTTDFAF--GVVNATVAMTMELPAAGFQGFDPWIS 318

Zfish   395 QIVPTAEETWLALMAI 410
            ||.....|:|:.:.|:
  Fly   319 QIERLVTESWVGVRAM 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cpa5NP_954965.1 Propep_M14 27..100 CDD:280416 4/14 (29%)
Peptidase_M14_like 118..417 CDD:299699 98/308 (32%)
CG32379NP_729252.2 M14_CP_A-B_like 44..338 CDD:199844 97/303 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170593469
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.750

Return to query results.
Submit another query.