DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nras and Rap1

DIOPT Version :9

Sequence 1:NP_542944.1 Gene:Nras / 24605 RGDID:3205 Length:189 Species:Rattus norvegicus
Sequence 2:NP_001189023.1 Gene:Rap1 / 38244 FlyBaseID:FBgn0004636 Length:184 Species:Drosophila melanogaster


Alignment Length:171 Identity:98/171 - (57%)
Similarity:127/171 - (74%) Gaps:1/171 - (0%)


- Green bases have known domain annotations that are detailed below.


  Rat     1 MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYS 65
            |.|||:||:|:|||||||||:|.:|..||::|||||||||||||.:||:.|:|:||||||.|:::
  Fly     1 MREYKIVVLGSGGVGKSALTVQFVQCIFVEKYDPTIEDSYRKQVEVDGQQCMLEILDTAGTEQFT 65

  Rat    66 AMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDL-PTRTVDTKQ 129
            ||||.||:.|:||:.|::|....:|.|:...||||.||||:|||||||||||||| ..|.|..:.
  Fly    66 AMRDLYMKNGQGFVLVYSITAQSTFNDLQDLREQILRVKDTDDVPMVLVGNKCDLEEERVVGKEL 130

  Rat   130 AHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKK 170
            ...||..:...|:|||||.:..|.|.||.|||:|.:...:|
  Fly   131 GKNLATQFNCAFMETSAKAKVNVNDIFYDLVRQINKKSPEK 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NrasNP_542944.1 H_N_K_Ras_like 3..164 CDD:133338 95/161 (59%)
Effector region 32..40 7/7 (100%)
Hypervariable region. /evidence=ECO:0000250 166..185 1/5 (20%)
Rap1NP_001189023.1 Rap1 3..165 CDD:133375 95/161 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000092
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100217
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.710

Return to query results.
Submit another query.