DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nras and Rala

DIOPT Version :9

Sequence 1:NP_542944.1 Gene:Nras / 24605 RGDID:3205 Length:189 Species:Rattus norvegicus
Sequence 2:NP_525063.1 Gene:Rala / 31332 FlyBaseID:FBgn0015286 Length:201 Species:Drosophila melanogaster


Alignment Length:178 Identity:92/178 - (51%)
Similarity:130/178 - (73%) Gaps:5/178 - (2%)


- Green bases have known domain annotations that are detailed below.


  Rat     4 YKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMR 68
            :|:::||:|||||||||:|.:.:.||::|:||..|||||:||:|||...:|||||||||:|:|:|
  Fly    12 HKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDTAGQEDYAAIR 76

  Rat    69 DQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDL-PTRTVDTKQAHE 132
            |.|.|:||||||||:|.:.:||.....:||||.|||:.:.:|.:|||||||| ..|.|...:...
  Fly    77 DNYFRSGEGFLCVFSITDDESFQATQEFREQILRVKNDESIPFLLVGNKCDLNDKRKVPLSECQL 141

  Rat   133 LAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSEDGTQG 180
            .|:.:.:|::|||||||:.|:..|:.|:||||.   :|...|: .|.|
  Fly   142 RAQQWAVPYVETSAKTRENVDKVFFDLMREIRS---RKTEDSK-ATSG 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NrasNP_542944.1 H_N_K_Ras_like 3..164 CDD:133338 86/160 (54%)
Effector region 32..40 4/7 (57%)
Hypervariable region. /evidence=ECO:0000250 166..185 4/15 (27%)
RalaNP_525063.1 RalA_RalB 12..174 CDD:206710 87/161 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1259506at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.