DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Npr1 and CG14877

DIOPT Version :9

Sequence 1:NP_036745.1 Gene:Npr1 / 24603 RGDID:3195 Length:1057 Species:Rattus norvegicus
Sequence 2:NP_650507.1 Gene:CG14877 / 41929 FlyBaseID:FBgn0038380 Length:254 Species:Drosophila melanogaster


Alignment Length:223 Identity:49/223 - (21%)
Similarity:84/223 - (37%) Gaps:61/223 - (27%)


- Green bases have known domain annotations that are detailed below.


  Rat    11 LRALLLLPPLLLLRGGHASDLTVAVVLPLTNTSYPWSWARVGPAVELALARVKARPDLLPG---- 71
            :|||:|||                     .:..|..|..||.|.:::|..::::: .|:|.    
  Fly    42 IRALVLLP---------------------DDNMYQASLPRVLPILKVAEQQIRSK-SLIPSHIDF 84

  Rat    72 -WTVRMVLGSSENAAGVCSDTAAPLAAVDLKWEHSPAVFLGPGCVYSAAPVGRFTAHWRVPLLTA 135
             |.....         .|..:...:.|:|...:....|..||.|.||.|.|.|.|.::.    :.
  Fly    85 EWLAHDT---------KCDASLGVIKAMDGIIKQCAQVIFGPVCDYSLAAVSRITKYFN----SQ 136

  Rat   136 GAPALGIG------------VKDEYALTTRTGP-SHVKLGDFVTALHRRLGWEHQALVLYADRLG 187
            |.|.:.:|            ..||:.:..|||. |...:.:....:.:|..|.|.  :.|.:|.|
  Fly   137 GTPLISVGGSTYDFEQKKTDCNDEFYMLLRTGMLSFETISELTINVMKRHNWSHS--IFYYERDG 199

  Rat   188 DD-----RPCFFIVEGLYMRVRERLNIT 210
            ..     ..||.:::.|..::|.. |:|
  Fly   200 QRSVAGMHTCFLMMKSLGKQMRNE-NMT 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Npr1NP_036745.1 PBP1_NPR_A 32..439 CDD:107380 43/202 (21%)
ANF_receptor 50..410 CDD:279440 41/184 (22%)
PK_GC-A_B 530..803 CDD:270944
TyrKc 543..797 CDD:197581
HNOBA <812..857 CDD:285003
CYCc 836..1025 CDD:214485
Guanylate_cyc 863..1049 CDD:278633
CG14877NP_650507.1 Periplasmic_Binding_Protein_Type_1 46..>241 CDD:299141 46/219 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.