DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Npr1 and Ac76E

DIOPT Version :9

Sequence 1:NP_036745.1 Gene:Npr1 / 24603 RGDID:3195 Length:1057 Species:Rattus norvegicus
Sequence 2:NP_001246838.1 Gene:Ac76E / 40180 FlyBaseID:FBgn0004852 Length:1312 Species:Drosophila melanogaster


Alignment Length:256 Identity:80/256 - (31%)
Similarity:127/256 - (49%) Gaps:48/256 - (18%)


- Green bases have known domain annotations that are detailed below.


  Rat   827 VEERTQAYLE-EKRKAEALLYQILPHSVAEQLKRG-----------------------ETVQAEA 867
            :|:|.:  || |:.:.|.||..::|..:|.::||.                       ..:..:.
  Fly   250 IEQRVK--LECEREQQEQLLLSVIPAYIAAEVKRSIMLKMADACQRAGGQASTSATRFHELHVQR 312

  Rat   868 FDSVTIYFSDIVGFTALSAESTPMQVVTLLNDLYTCFDAVIDNFDVYKVETIGDAYMVVSGLPVR 932
            ..:|||.|:|||.||.||:..|...:|..||||:..||.:.......:::.:||.|..|||||:.
  Fly   313 HTNVTILFADIVNFTPLSSSLTASDLVKTLNDLFGRFDQIAQENQCLRIKILGDCYYCVSGLPIS 377

  Rat   933 NGQLHAREVARMALALLDAVRSFRIRHRPQEQLRLRIGIHTGPVCAGVVGLKMPRYCLFGDTVNT 997
            ..| ||.....|.|.::||:|  .:|......:.:|||||||.|..||:||:..::.::.|.|..
  Fly   378 RPQ-HATNCVNMGLQMIDAIR--HVREATGINVDMRIGIHTGNVLCGVLGLRKWQFDVWSDDVTL 439

  Rat   998 ASRMESNGEALKIHLSSETKAVLEEFDGFELELRGDVEMKGKG----------KVRTYWLL 1048
            |:.|||.|.|.::|::.:|...|.  |.||:|       :|:|          ||.:|.::
  Fly   440 ANHMESGGVAGRVHITKQTLDFLG--DKFEVE-------QGEGGNRDAYLADHKVESYLIV 491

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Npr1NP_036745.1 PBP1_NPR_A 32..439 CDD:107380
ANF_receptor 50..410 CDD:279440
PK_GC-A_B 530..803 CDD:270944
TyrKc 543..797 CDD:197581
HNOBA <812..857 CDD:285003 10/30 (33%)
CYCc 836..1025 CDD:214485 68/212 (32%)
Guanylate_cyc 863..1049 CDD:278633 68/196 (35%)
Ac76ENP_001246838.1 AC_N <67..289 CDD:292831 12/40 (30%)
CYCc 259..467 CDD:214485 68/212 (32%)
Guanylate_cyc 311..469 CDD:278633 62/162 (38%)
BASP1 510..667 CDD:283191
CYCc 1079..1283 CDD:214485
Guanylate_cyc 1101..1305 CDD:278633
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.