DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Npr1 and CG33958

DIOPT Version :9

Sequence 1:NP_036745.1 Gene:Npr1 / 24603 RGDID:3195 Length:1057 Species:Rattus norvegicus
Sequence 2:NP_001033958.1 Gene:CG33958 / 37088 FlyBaseID:FBgn0053958 Length:710 Species:Drosophila melanogaster


Alignment Length:559 Identity:187/559 - (33%)
Similarity:270/559 - (48%) Gaps:136/559 - (24%)


- Green bases have known domain annotations that are detailed below.


  Rat   615 SLQDILENESITLDWMFRYSLTNDIVKGM--LFLHNGAIC----SHGNLKSSNCVVDGRFVLKIT 673
            :||:|||..|...|...:.::..|:.|.:  |.|....:.    ::|:.:.:|..:  ||.  .|
  Fly   131 TLQEILEYRSAVADIETQVTIATDLGKVVTRLQLERSEVAFYIFTNGSKQRANLTL--RFA--NT 191

  Rat   674 DYGLES-----------------------------------FRDP---EPEQGHTLFAKKLWTAP 700
            |:.|.:                                   |||.   |||:.........:|:.
  Fly   192 DHALNNMTTWSEISVPTAPDEDEDDREMMLNRYEFQSRLNEFRDRVRLEPEESSITEVMNWYTSI 256

  Rat   701 E--LLRMASPPARGSQAGDVYSF---------GIILQEIALRSGV-FYVEG-------------- 739
            .  ||...|...:.:....|:.:         .|..|.||...|: :|..|              
  Fly   257 NRGLLHHLSEQIKETDNSGVWRYLVGFKNLLKSIECQNIATSFGIRYYGRGSLTAENFVSYVRYE 321

  Rat   740 ----------LDLSP--KEIIERVT------RGEQP-----PFRPSMDLQSHLEELGQLMQRCWA 781
                      |:.:|  |.:...:|      |.:|.     ...|::..:....|..:||.. :.
  Fly   322 FMAREMINSTLNYAPMLKNMYTNITSTKKFHRAKQMGTTLLKNNPNVSNERSAIEYYELMNN-YT 385

  Rat   782 EDPQERPPFQQIRLALRKFNKENSSN----------------------------ILDNLLSRMEQ 818
            :|      .:.::.|||:..||....                            ::.|..:.::.
  Fly   386 DD------LRILQKALRRLIKEYVDKTLVEADRKEAIGIAILVVVLIVSPVIIVLVKNAAATIQL 444

  Rat   819 YANNLEELVEERTQAYLEEKRKAEALLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTA 883
            ||.||.:..:|..:    ||||:::||:|:||.|||.|||:.:.|.||.:::||||||||||||.
  Fly   445 YALNLSQKAKELKR----EKRKSDSLLFQMLPPSVAMQLKQTQQVPAELYEAVTIYFSDIVGFTE 505

  Rat   884 LSAESTPMQVVTLLNDLYTCFDAVIDNFDVYKVETIGDAYMVVSGLPVRNGQLHAREVARMALAL 948
            ::|:.||::|||.||.:|..||..|:.:||||||||||:|||.|||||:||..|..|:|.|||.|
  Fly   506 IAADCTPLEVVTFLNSIYRVFDERIECYDVYKVETIGDSYMVASGLPVKNGNKHISEIATMALDL 570

  Rat   949 LDAVRSFRIRHRPQEQLRLRIGIHTGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGEALKIHLS 1013
            |||...|||.....|.:::|.|:|||||.||:||.||||||||||||||||||||.|||.|||::
  Fly   571 LDASSVFRIPRAGDEFVQIRCGVHTGPVVAGIVGTKMPRYCLFGDTVNTASRMESTGEAQKIHIT 635

  Rat  1014 SETKAVLEEFDGFELELRGDVEMKGKGKVRTYWLLGERG 1052
            .|....|::..||..|.||.:::||||.:.||||..:.|
  Fly   636 EEMHDSLQQVGGFRTEHRGLIDVKGKGLMSTYWLTCKDG 674

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Npr1NP_036745.1 PBP1_NPR_A 32..439 CDD:107380
ANF_receptor 50..410 CDD:279440
PK_GC-A_B 530..803 CDD:270944 50/280 (18%)
TyrKc 543..797 CDD:197581 47/274 (17%)
HNOBA <812..857 CDD:285003 17/44 (39%)
CYCc 836..1025 CDD:214485 115/188 (61%)
Guanylate_cyc 863..1049 CDD:278633 113/185 (61%)
CG33958NP_001033958.1 NIT 159..396 CDD:285564 39/247 (16%)
HNOBA <439..479 CDD:285003 17/43 (40%)
CYCc 459..647 CDD:214485 115/187 (61%)
Guanylate_cyc 485..669 CDD:278633 111/183 (61%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.