Sequence 1: | NP_036745.1 | Gene: | Npr1 / 24603 | RGDID: | 3195 | Length: | 1057 | Species: | Rattus norvegicus |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001259575.1 | Gene: | Ac13E / 32485 | FlyBaseID: | FBgn0022710 | Length: | 1703 | Species: | Drosophila melanogaster |
Alignment Length: | 251 | Identity: | 80/251 - (31%) |
---|---|---|---|
Similarity: | 133/251 - (52%) | Gaps: | 42/251 - (16%) |
- Green bases have known domain annotations that are detailed below.
Rat 837 EKRKAEALLYQILPHSVAEQL-----------------------KRGETVQA-------EAFDSV 871
Rat 872 TIYFSDIVGFTALSAESTPMQVVTLLNDLYTCFDAVIDNFDVYKVETIGDAYMVVSGLPVRNGQL 936
Rat 937 HAREVARMALALLDAVRSFRI-RHRPQEQLRLRIGIHTGPVCAGVVGLKMPRYCLFGDTVNTASR 1000
Rat 1001 MESNGEALKIHLSSETKAVLEEFDGFELELRGDVEMKGKGKVRTYWLLGERGCSTR 1056 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Npr1 | NP_036745.1 | PBP1_NPR_A | 32..439 | CDD:107380 | |
ANF_receptor | 50..410 | CDD:279440 | |||
PK_GC-A_B | 530..803 | CDD:270944 | |||
TyrKc | 543..797 | CDD:197581 | |||
HNOBA | <812..857 | CDD:285003 | 6/19 (32%) | ||
CYCc | 836..1025 | CDD:214485 | 67/218 (31%) | ||
Guanylate_cyc | 863..1049 | CDD:278633 | 69/193 (36%) | ||
Ac13E | NP_001259575.1 | CYCc | 302..518 | CDD:214485 | 68/220 (31%) |
Guanylate_cyc | 361..535 | CDD:278633 | 68/184 (37%) | ||
CYCc | 1362..1556 | CDD:214485 | |||
Guanylate_cyc | 1388..1575 | CDD:278633 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG2114 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |