DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ATP6V1C2 and atp6v1c2

DIOPT Version :9

Sequence 1:XP_011508641.1 Gene:ATP6V1C2 / 245973 HGNCID:18264 Length:437 Species:Homo sapiens
Sequence 2:XP_002940167.1 Gene:atp6v1c2 / 100485790 XenbaseID:XB-GENE-962058 Length:381 Species:Xenopus tropicalis


Alignment Length:437 Identity:274/437 - (62%)
Similarity:334/437 - (76%) Gaps:57/437 - (13%)


- Green bases have known domain annotations that are detailed below.


Human     1 MSEFWLISAPGDKENLQALERMNTVTSKSNLSYNTKFAIPDFKVGTLDSLVGLSDELGKLDTFAE 65
            |||.||||.||||.||.||:||||||||:|||.|.||.||:.||||||:||||||||||||.:||
 Frog     1 MSELWLISVPGDKTNLTALDRMNTVTSKANLSSNAKFVIPELKVGTLDALVGLSDELGKLDAYAE 65

Human    66 SLIRRMAQSVVEVMEDSKGKVQEHLLANGGLKGKMKCLKIDLTSFVTHFEWDMAKYPVKQPLVSV 130
            |||:::||.:.|||:||..|.||:|||||          :||.|::..||||||||||||||.::
 Frog    66 SLIKKIAQYIGEVMDDSTDKAQENLLANG----------VDLISYLARFEWDMAKYPVKQPLKNI 120

Human   131 VDTIAKQLAQIEMDLKSRTAAYNTLKTNLENLEKKSMGNLFTRTLSDIVSKEDFVLDSEYLVTLL 195
            ::.::||::||:.|||||::|||.:|.:|::||:|::|||.||||:|||:|||||||||||||||
 Frog   121 MEVLSKQMSQIDTDLKSRSSAYNNIKGSLQSLERKTVGNLLTRTLADIVNKEDFVLDSEYLVTLL 185

Human   196 VIVPKPNYSQWQKTYESLSDMVVPRSTKLITEDKEGGLFTVTLFRKVIEDFKTKAKENKFTVREF 260
            |:|||.:|..||||||||||||||||||:|.||.|||||||||||||::|||.||:||||.||||
 Frog   186 VVVPKSSYGAWQKTYESLSDMVVPRSTKMIAEDAEGGLFTVTLFRKVMDDFKAKARENKFIVREF 250

Human   261 YYDEKEIEREREEMARLLSDKKQQYQTSCVALKKGSSTFPDHKVKVTPLGNPDRPAAGQTDRERE 325
            .::|||::.|:.|:.:|.:||||.|                                        
 Frog   251 LFNEKELQSEKAEIVKLAADKKQLY---------------------------------------- 275

Human   326 SEGEGEGPLLRWLKVNFSEAFIAWIHIKALRVFVESVLRYGLPVNFQAVLLQPHKKSSTKRLREV 390
                  ||||||||||||||||.||||||||||||||||||||||||||:|||:|| |.||||:|
 Frog   276 ------GPLLRWLKVNFSEAFIGWIHIKALRVFVESVLRYGLPVNFQAVVLQPNKK-SMKRLRDV 333

Human   391 LNSVFRHLDEVAATSILDASVEIPGLQLNNQDYFPYVYFHIDLSLLD 437
            ||::||||||.||.::.|..:|||||||::|||:|||.|.|||:.||
 Frog   334 LNAIFRHLDENAAANMKDIGMEIPGLQLSSQDYYPYVCFKIDLTNLD 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ATP6V1C2XP_011508641.1 V-ATPase_C 5..427 CDD:397366 263/421 (62%)
3-helical coiled coil 55..75 CDD:270211 14/19 (74%)
3-helical coiled coil 130..156 CDD:270211 12/25 (48%)
3-helical coiled coil 284..361 CDD:270211 28/76 (37%)
atp6v1c2XP_002940167.1 V-ATPase_C 5..370 CDD:367405 263/421 (62%)
3-helical coiled coil 55..75 CDD:270211 14/19 (74%)
3-helical coiled coil 120..146 CDD:270211 12/25 (48%)
3-helical coiled coil 274..305 CDD:270211 28/76 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 525 1.000 Domainoid score I3337
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H15866
Inparanoid 1 1.050 540 1.000 Inparanoid score I7166
NCBI 1 1.000 - -
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1016088at2759
OrthoFinder 1 1.000 - - FOG0001981
OrthoInspector 1 1.000 - - oto154857
Panther 1 1.100 - - LDO PTHR10137
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1630
SonicParanoid 1 1.000 - - X1294
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1010.190

Return to query results.
Submit another query.