DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ncam1 and DIP-theta

DIOPT Version :9

Sequence 1:XP_038936733.1 Gene:Ncam1 / 24586 RGDID:67378 Length:1136 Species:Rattus norvegicus
Sequence 2:NP_723103.1 Gene:DIP-theta / 33795 FlyBaseID:FBgn0051646 Length:606 Species:Drosophila melanogaster


Alignment Length:372 Identity:86/372 - (23%)
Similarity:149/372 - (40%) Gaps:63/372 - (16%)


- Green bases have known domain annotations that are detailed below.


  Rat   119 MFKNAPTPQEFKEGEDAVIVCDVVSSLPPTIIWKHKGRDVILKKDVRFIVLSNNY---------- 173
            :.:|...|    ...:||:.|.|.:.....|.|.......||  .::..|::.|:          
  Fly   135 LLQNVTVP----VSREAVLQCVVDNLQTYKIAWLRVDTQTIL--TIQNHVITKNHRMSITHAEKR 193

  Rat   174 ---LQIRGIKKTDEGTYRCE-GRILARGEINFKDIQVIVNVPPTVQARQSIVNATANLGQSVTLV 234
               |:||.:|::|:|.|.|: .....:.::.:.|    |.|||.:....:..:.....|.:|||.
  Fly   194 AWILRIRDVKESDKGWYMCQINTDPMKSQVGYLD----VVVPPDILDYPTSTDMVIREGSNVTLK 254

  Rat   235 CDADGFPEPTMSWTKDGE---PIENEEEDDEKHIFSDDSSELTIRNVDKNDEAEYVCIAENKAGE 296
            |.|.|.|.||::|.::|.   |:.|..|     ..:.:.|.|||..|::.:...|:|||.|....
  Fly   255 CAATGSPTPTITWRREGGELIPLPNGAE-----AVAYNGSFLTIAKVNRLNMGAYLCIASNGIPP 314

  Rat   297 QDASIHLKVFAKPKITYVENQ-TAMELEEQVTLTCEASGDPIPSITWRTSTRNISSEEKASWTRP 360
            ..:...:.:...|.:.:::|| ....|.:.:||.|::...|.....|..:...|...|:..   |
  Fly   315 TVSKRVMLIVHFPPMIWIQNQLVGAALTQNITLECQSEAYPKSINYWMKNDTIIVPGERFV---P 376

  Rat   361 EKQETLDGHMVVRSHARVSSLTLKSIQYTDAGEYICTASNTIGQDSQSMYLEVQYAPKLQGPVAV 425
            |..|:  |:.:      ...||:..:...|.|.|.|.|.|::|.              ..|.:.:
  Fly   377 ETFES--GYKI------TMRLTIYEVDIQDFGAYRCVAKNSLGD--------------TDGAIKL 419

  Rat   426 Y----TWEGNQVNITCEVFAYPSATISWFRDGQLLPSSNYSNIKIYN 468
            |    |.....:..|..:...|...:.:.:: |...||..||...||
  Fly   420 YHIPQTTTMTTMAPTVSINTVPVVLVKYNKE-QRYGSSQNSNTNPYN 465

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ncam1XP_038936733.1 IgI_1_NCAM-1 20..116 CDD:409451
Ig strand B 37..41 CDD:409451
Ig strand C 51..55 CDD:409451
Ig strand E 79..83 CDD:409451
Ig strand F 93..98 CDD:409451
Ig strand G 107..110 CDD:409451
IG_like 124..190 CDD:214653 18/78 (23%)
Ig strand B 135..139 CDD:409353 2/3 (67%)
Ig strand C 148..152 CDD:409353 1/3 (33%)
Ig strand E 172..176 CDD:409353 2/16 (13%)
Ig strand F 186..191 CDD:409353 2/5 (40%)
IgI_3_NCAM-1 211..308 CDD:143207 27/99 (27%)
Ig strand B 231..235 CDD:143207 3/3 (100%)
Ig strand C 244..248 CDD:143207 1/3 (33%)
Ig strand E 271..275 CDD:143207 2/3 (67%)
Ig strand F 285..290 CDD:143207 2/4 (50%)
Ig strand G 298..301 CDD:143207 0/2 (0%)
IgI_NCAM-1 307..413 CDD:143277 24/106 (23%)
Ig strand B 326..330 CDD:143277 2/3 (67%)
Ig strand C 339..343 CDD:143277 0/3 (0%)
Ig strand E 379..383 CDD:143277 1/3 (33%)
Ig strand F 393..398 CDD:143277 2/4 (50%)
Ig strand G 406..409 CDD:143277 0/2 (0%)
Ig_3 422..494 CDD:404760 11/51 (22%)
Ig strand B 433..437 CDD:409353 0/3 (0%)
Ig strand C 446..450 CDD:409353 0/3 (0%)
Ig strand E 473..477 CDD:409353
Ig strand F 487..492 CDD:409353
FN3 509..606 CDD:238020
fn3 619..701 CDD:394996
Herpes_BLLF1 <842..1133 CDD:282904
DIP-thetaNP_723103.1 Ig 137..230 CDD:299845 22/102 (22%)
IG_like 137..230 CDD:214653 22/102 (22%)
IG_like 240..324 CDD:214653 25/88 (28%)
IGc2 247..310 CDD:197706 24/67 (36%)
Ig 327..419 CDD:299845 25/116 (22%)
IG_like 343..420 CDD:214653 21/101 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12231
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.