| Sequence 1: | XP_038936733.1 | Gene: | Ncam1 / 24586 | RGDID: | 67378 | Length: | 1136 | Species: | Rattus norvegicus |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001259218.1 | Gene: | DIP-alpha / 31322 | FlyBaseID: | FBgn0052791 | Length: | 554 | Species: | Drosophila melanogaster |
| Alignment Length: | 328 | Identity: | 78/328 - (23%) |
|---|---|---|---|
| Similarity: | 118/328 - (35%) | Gaps: | 77/328 - (23%) |
- Green bases have known domain annotations that are detailed below.
|
Rat 132 GEDAVIVCDVVSSLPPTIIWKHKG--RDVILKKDVRFI------VLSNN-------------YLQ 175
Rat 176 IRGIKKTDEGTYRCE-GRILARGEINFKDIQVIVNVPPTVQARQSIVNATANLGQSVTLVCDADG 239
Rat 240 FPEPTMSWTK-DGEPIENEEEDDEKHIFSDDSSE-LTIRNVDKNDEAEYVCIAENKAGEQ-DASI 301
Rat 302 HLKVFAKPKITYVENQTAMELEEQVTLTCEASGDPIPSITWRTSTRNISSEEKASWTRPEKQETL 366
Rat 367 DGHMVVRS---HARVS---------SLTLKSIQYTDAGEYICTASNTIGQDSQSMYLEVQYAPKL 419
Rat 420 QGP 422 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Ncam1 | XP_038936733.1 | IgI_1_NCAM-1 | 20..116 | CDD:409451 | |
| Ig strand B | 37..41 | CDD:409451 | |||
| Ig strand C | 51..55 | CDD:409451 | |||
| Ig strand E | 79..83 | CDD:409451 | |||
| Ig strand F | 93..98 | CDD:409451 | |||
| Ig strand G | 107..110 | CDD:409451 | |||
| IG_like | 124..190 | CDD:214653 | 19/78 (24%) | ||
| Ig strand B | 135..139 | CDD:409353 | 1/3 (33%) | ||
| Ig strand C | 148..152 | CDD:409353 | 0/3 (0%) | ||
| Ig strand E | 172..176 | CDD:409353 | 2/16 (13%) | ||
| Ig strand F | 186..191 | CDD:409353 | 2/5 (40%) | ||
| IgI_3_NCAM-1 | 211..308 | CDD:143207 | 27/99 (27%) | ||
| Ig strand B | 231..235 | CDD:143207 | 2/3 (67%) | ||
| Ig strand C | 244..248 | CDD:143207 | 0/3 (0%) | ||
| Ig strand E | 271..275 | CDD:143207 | 2/4 (50%) | ||
| Ig strand F | 285..290 | CDD:143207 | 2/4 (50%) | ||
| Ig strand G | 298..301 | CDD:143207 | 0/2 (0%) | ||
| IgI_NCAM-1 | 307..413 | CDD:143277 | 25/117 (21%) | ||
| Ig strand B | 326..330 | CDD:143277 | 1/3 (33%) | ||
| Ig strand C | 339..343 | CDD:143277 | 0/3 (0%) | ||
| Ig strand E | 379..383 | CDD:143277 | 2/12 (17%) | ||
| Ig strand F | 393..398 | CDD:143277 | 2/4 (50%) | ||
| Ig strand G | 406..409 | CDD:143277 | 0/2 (0%) | ||
| Ig_3 | 422..494 | CDD:404760 | 1/1 (100%) | ||
| Ig strand B | 433..437 | CDD:409353 | |||
| Ig strand C | 446..450 | CDD:409353 | |||
| Ig strand E | 473..477 | CDD:409353 | |||
| Ig strand F | 487..492 | CDD:409353 | |||
| FN3 | 509..606 | CDD:238020 | |||
| fn3 | 619..701 | CDD:394996 | |||
| Herpes_BLLF1 | <842..1133 | CDD:282904 | |||
| DIP-alpha | NP_001259218.1 | IG_like | 49..129 | CDD:214653 | 20/82 (24%) |
| Ig | 51..131 | CDD:299845 | 20/84 (24%) | ||
| I-set | 144..240 | CDD:254352 | 26/95 (27%) | ||
| IGc2 | 159..228 | CDD:197706 | 23/68 (34%) | ||
| Ig | 244..337 | CDD:299845 | 24/113 (21%) | ||
| I-set | 244..337 | CDD:254352 | 24/113 (21%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | O | PTHR12231 |
| Phylome | 1 | 0.910 | - | - | ||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 3 | 2.910 | |||||