DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mylpf and sqh

DIOPT Version :9

Sequence 1:XP_038953516.1 Gene:Mylpf / 24584 RGDID:3141 Length:191 Species:Rattus norvegicus
Sequence 2:NP_001284928.1 Gene:sqh / 31554 FlyBaseID:FBgn0003514 Length:174 Species:Drosophila melanogaster


Alignment Length:193 Identity:92/193 - (47%)
Similarity:116/193 - (60%) Gaps:30/193 - (15%)


- Green bases have known domain annotations that are detailed below.


  Rat     4 KKAKRRA-----AAEGSSNVFSMFDQTQIQEFKEAFTVIDQNRDGIIDKEDLRDTFAAMGRLNVK 63
            |.|.|||     |...:||||:||||.||.||||||.:|||||||.::||||.|..|::|: |..
  Fly     5 KTAGRRATTKKRAQRATSNVFAMFDQAQIAEFKEAFNMIDQNRDGFVEKEDLHDMLASLGK-NPT 68

  Rat    64 NEELDAMMKEASGPINFTVFLTMFGEKLKGADPEDVITGAFKVLDPEGKGTIKKQFLEELLTTQC 128
            ::.||.||.||.||||||:|||:|||:|:|.||||||..||...|.|..|.:.:..|.|||||..
  Fly    69 DDYLDGMMNEAPGPINFTMFLTLFGERLQGTDPEDVIKNAFGCFDEENMGVLPEDRLRELLTTMG 133

  Rat   129 DRFSQEEVSRGEPREEKDSEWKPTPVFLQIKNMWAAFPPDVGGNVDYKNICYVITHGDAKDQE 191
            |||:.|:|         |..::..|    |||          |..||.....::.|| |||::
  Fly   134 DRFTDEDV---------DEMYREAP----IKN----------GLFDYLEFTRILKHG-AKDKD 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MylpfXP_038953516.1 FRQ1 15..136 CDD:227455 72/120 (60%)
sqhNP_001284928.1 FRQ1 15..170 CDD:227455 85/179 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0031
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1435392at2759
OrthoFinder 1 1.000 - - FOG0000218
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23049
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X162
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.