DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mbl1 and CG7763

DIOPT Version :9

Sequence 1:NP_036731.2 Gene:Mbl1 / 24548 RGDID:3055 Length:238 Species:Rattus norvegicus
Sequence 2:NP_001356891.1 Gene:CG7763 / 36235 FlyBaseID:FBgn0040503 Length:232 Species:Drosophila melanogaster


Alignment Length:260 Identity:53/260 - (20%)
Similarity:98/260 - (37%) Gaps:66/260 - (25%)


- Green bases have known domain annotations that are detailed below.


  Rat     2 LLLPLLVLLCVVSVSSSGSQTCE--ETLKTCSVIACGRDGRDGPKGEKGEPGQGLRGLQGPPGKL 64
            |:||    ||   :|||.|..||  |:...|:....                          |.|
  Fly     8 LVLP----LC---LSSSYSAACEGVESDSQCAAYCY--------------------------GVL 39

  Rat    65 GPPGSVGAPGSQGPKGQKGDRGDSRAIEVKLANMEAEINTL--KSKLELTNK-------LHAFSM 120
            .|     ...|.|...::.:..::.....::|..:..::..  .:.|:|.|:       .|..:|
  Fly    40 NP-----CIASMGNLQRRVEACEAAVAIARIALNDRRLDNFGTSTNLQLENQNTSQQLLTHGTAM 99

  Rat   121 GKK----------SGKKFFVTNHERMPFSKVKALCSELRGTVAIPRNAEE----NKAIQEVAKTS 171
            |:|          ..|.:::...|::.:......|.::.|.:|..::.||    |..:..:.:  
  Fly   100 GRKLEENEIFQQLGSKYYYIEKEEKLNWHDALDKCHKMGGHLASLQSQEELDRFNNQLNGLNR-- 162

  Rat   172 AFLGITDEVTEGQFMYVT-GGRLTYSNWKKDEPNDHGSGEDCVTIVDNGLWNDISCQASHTAVCE 235
            .::.:|::..|.:|:.|| |.:..:.:|...||...|...|..|.......||.||.|:...:||
  Fly   163 YWIDVTNQFNESEFVSVTKGSKANFLSWADGEPTKDGECVDIRTFNGKTTMNDNSCFANLYFICE 227

  Rat   236  235
              Fly   228  227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mbl1NP_036731.2 Collagen 36..>88 CDD:189968 5/51 (10%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 38..87 5/48 (10%)
CLECT_collectin_like 126..236 CDD:153061 27/115 (23%)
Calcium-dependent carbohydrate binding. /evidence=ECO:0000269|PubMed:11850428, ECO:0000269|PubMed:1436090, ECO:0000269|PubMed:9033386 202..210 3/7 (43%)
CG7763NP_001356891.1 CLECT 116..228 CDD:153057 26/114 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.