DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lalba and LysS

DIOPT Version :9

Sequence 1:NP_036726.1 Gene:Lalba / 24528 RGDID:2987 Length:159 Species:Rattus norvegicus
Sequence 2:NP_476829.1 Gene:LysS / 38130 FlyBaseID:FBgn0004430 Length:140 Species:Drosophila melanogaster


Alignment Length:126 Identity:39/126 - (30%)
Similarity:68/126 - (53%) Gaps:6/126 - (4%)


- Green bases have known domain annotations that are detailed below.


  Rat     1 MMRFVPLFLACISLPAFQATEFTKCEVSHAIEDMDGYQGISLLEWTCVLFHTSGYDSQAI--VKN 63
            |..|..|.|..|:.||.......:|.::..:.|: |.....|.:|||:..|.|.|.:..:  ..:
  Fly     1 MKAFFALVLLAIAAPALAGRTLDRCSLAREMADL-GVPRDQLDKWTCIAQHESDYRTWVVGPANS 64

  Rat    64 NGSTEYGLFQISNRNWCKS-SEFPESENICDISCDKFLDDELADDIVCAKKIVAIKGIDYW 123
            :||.:||:|||::..||:: ..|  |.|.|.:||:..|.|::.:.:.||:|:::.:|...|
  Fly    65 DGSNDYGIFQINDLYWCQADGRF--SYNECGLSCNALLTDDITNSVRCAQKVLSQQGWSAW 123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LalbaNP_036726.1 Lys 20..137 CDD:395016 32/107 (30%)
LysSNP_476829.1 LYZ1 20..140 CDD:197612 32/107 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166347553
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2BPI7
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1551203at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11407
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
76.810

Return to query results.
Submit another query.