DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nim1k and par-1

DIOPT Version :9

Sequence 1:NP_780747.1 Gene:Nim1k / 245269 MGIID:2442399 Length:436 Species:Mus musculus
Sequence 2:NP_995894.2 Gene:par-1 / 2768852 FlyBaseID:FBgn0260934 Length:1170 Species:Drosophila melanogaster


Alignment Length:403 Identity:145/403 - (35%)
Similarity:219/403 - (54%) Gaps:57/403 - (14%)


- Green bases have known domain annotations that are detailed below.


Mouse    30 QTEGGKDSEEDQQRQLTPFE-KLTQDMCQDEKVVREITLGKRIGFYRIRGEIGSGNFSQVKLGIH 93
            :|...|.|...|.|...|.. :.|::               .||.|::...||.|||::|||..|
  Fly   223 RTSSAKGSPNMQMRSSAPMRWRATEE---------------HIGKYKLIKTIGKGNFAKVKLAKH 272

Mouse    94 SLTKEKVAIKILDKTKLDQKTQRLLSREISSMEKLHHPNIVRLYEVVETLSKLHLVMEYAGGGEL 158
            ..|.::|||||:|||:|:..:.:.|.||:..|:.|.|||||:|::|:||...|:|:||||.|||:
  Fly   273 LPTGKEVAIKIIDKTQLNPGSLQKLFREVRIMKMLDHPNIVKLFQVIETEKTLYLIMEYASGGEV 337

Mouse   159 FGKISTEGKLSEPESKLIFSQILSAVKHMHENQIIHRDLKAENVFYTSRTCVKVGDFGFSTVSKK 223
            |..:...|::.|.|:::.|.||:|||::.|:.:||||||||||:...|...:|:.|||||.....
  Fly   338 FDYLVLHGRMKEKEARVKFRQIVSAVQYCHQKRIIHRDLKAENLLLDSELNIKIADFGFSNEFTP 402

Mouse   224 GEMLNTFCGSPPYAAPELFRDQHYVGVYVDIWALGVLLYFMVTGTMPFRAETVAKLKKSILEGTY 288
            |..|:||||||||||||||:.:.|.|..||:|:|||:||.:|:|::||...|:.:|::.:|.|.|
  Fly   403 GSKLDTFCGSPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDGSTLRELRERVLRGKY 467

Mouse   289 TIPQHVSEPCHRLIRGVLQPTPTERYGINYIMSNEWMRGVPYPTPLEPF------QLDPKHLSET 347
            .||.::|..|..|:|..|...|.:|..:..||.::||........|:|:      ..|||.:...
  Fly   468 RIPFYMSTDCENLLRKFLVLNPAKRASLETIMGDKWMNMGFEEDELKPYIEPKADLADPKRIEAL 532

Mouse   348 STLKEEENEVKSTLEHLGITDE-------------------------HIRNNQGRDARSSI---- 383
            ..:....:|::::|..:...|.                         .:||..|.||.::.    
  Fly   533 VAMGYNRSEIEASLSQVRYDDVFATYLLLGRKSTDPESDGSRSGSSLSLRNISGNDAGANAGSAS 597

Mouse   384 ------TGVYRII 390
                  .||:|.|
  Fly   598 VQSPTHRGVHRSI 610

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nim1kNP_780747.1 STKc_NIM1 71..325 CDD:270977 119/253 (47%)
S_TKc 74..325 CDD:214567 117/250 (47%)
par-1NP_995894.2 STKc_MARK 252..504 CDD:270974 117/251 (47%)
S_TKc 253..504 CDD:214567 117/250 (47%)
UBA_MARK_Par1 525..563 CDD:270522 6/37 (16%)
MARK1-3_C 839..936 CDD:213381
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.