DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ins2 and Ilp5

DIOPT Version :9

Sequence 1:XP_038952432.1 Gene:Ins2 / 24506 RGDID:2916 Length:119 Species:Rattus norvegicus
Sequence 2:NP_996037.2 Gene:Ilp5 / 2768992 FlyBaseID:FBgn0044048 Length:108 Species:Drosophila melanogaster


Alignment Length:118 Identity:33/118 - (27%)
Similarity:45/118 - (38%) Gaps:32/118 - (27%)


- Green bases have known domain annotations that are detailed below.


  Rat    17 LPLLALLILWEPRP----AQAFVKQHLCGSHLVEALYLVC-----------GERGFFYTPMSRRE 66
            :|:|..||     |    |||......||..|::.|.:.|           |..|.|       :
  Fly     7 IPVLLFLI-----PLLLSAQAANSLRACGPALMDMLRVACPNGFNSMFAKRGTLGLF-------D 59

  Rat    67 VEDPQVAQLELGGGPGAGDLQTLALEVARQKRGIVDQCCTSICSLYQLENYCN 119
            .|| .:|.|:.........|.:    :.|..||:||.||...||...|..||:
  Fly    60 YED-HLADLDSSESHHMNSLSS----IRRDFRGVVDSCCRKSCSFSTLRAYCD 107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ins2XP_038952432.1 IlGF_insulin_like 35..119 CDD:239833 24/94 (26%)
Ilp5NP_996037.2 IlGF_insulin_bombyxin_like 29..106 CDD:239832 23/88 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.