DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Inha and scw

DIOPT Version :9

Sequence 1:NP_036722.1 Gene:Inha / 24504 RGDID:2912 Length:366 Species:Rattus norvegicus
Sequence 2:NP_001286088.1 Gene:scw / 46000 FlyBaseID:FBgn0005590 Length:400 Species:Drosophila melanogaster


Alignment Length:293 Identity:63/293 - (21%)
Similarity:91/293 - (31%) Gaps:112/293 - (38%)


- Green bases have known domain annotations that are detailed below.


  Rat   112 FTYVFRPSQHIRSHQ--------VTSAQLWFHT-GLDRKSTAASNSSRPLLDLLVLSSGGPMAVP 167
            |:|....|.:..|.|        ..:.:.|.|. ||.|:     |..|                 
  Fly   180 FSYRILGSVNTTSSQRGWLEFNLTDTLRYWLHNKGLQRR-----NELR----------------- 222

  Rat   168 VSLGQSPPRWAVLHLAASAFPLLTHPILVLLLRCPLCSCSGRPETTPFLVAH----------TRA 222
            :|:|.|       .|:..|..|:|          |..|   |....||:|.:          .:.
  Fly   223 ISIGDS-------QLSTFAAGLVT----------PQAS---RTSLEPFIVGYFNGPELLVKIQKL 267

  Rat   223 RAPSAGERARRSAPSMPWPWSPAALRLLQRPPEEPSAHAFCHRAALNISFQELGWDRWIVHPPSF 287
            |.....|:.|....|.|.|..|..  .|.|||:.      |.|....:.|:||....|::.|..|
  Fly   268 RFKRDLEKRRAGGGSPPPPPPPPV--DLYRPPQS------CERLNFTVDFKELHMHNWVIAPKKF 324

  Rat   288 IFHYCHGSCGMPTSD-------------LPLPVPGAPPTPAQPLFLVPGAKPCCA-ALPGSMRSL 338
            ..::|.|.|..|...             :.|..|..|             ||||. .:.|::..|
  Fly   325 EAYFCGGGCNFPLGTKMNATNHAIVQTLMHLKQPHLP-------------KPCCVPTVLGAITIL 376

  Rat   339 R------VRTTSDGGYSFKYEMVPNLITQHCAC 365
            |      :..|       ||:   ..:.:.|.|
  Fly   377 RYLNEDIIDLT-------KYQ---KAVAKECGC 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
InhaNP_036722.1 TGFB 263..366 CDD:214556 27/123 (22%)
scwNP_001286088.1 TGFb_propeptide 39..254 CDD:279078 25/115 (22%)
TGFB 300..400 CDD:214556 27/123 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.