DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Igf2 and Ilp6

DIOPT Version :9

Sequence 1:XP_008758296.1 Gene:Igf2 / 24483 RGDID:2870 Length:326 Species:Rattus norvegicus
Sequence 2:NP_001188538.1 Gene:Ilp6 / 31220 FlyBaseID:FBgn0044047 Length:107 Species:Drosophila melanogaster


Alignment Length:103 Identity:29/103 - (28%)
Similarity:39/103 - (37%) Gaps:23/103 - (22%)


- Green bases have known domain annotations that are detailed below.


  Rat   167 IPVGKSMLVLLISLAFALCC------IAA-------YRPSETLCGGELVDTLQFVCSD----RGF 214
            :|..|.:|||....|.|...      :||       |.....:|...|.|.:|.:|..    .|.
  Fly     5 VPTSKVLLVLATLFAVAAMISSWMPQVAASPLAPTEYEQRRMMCSTGLSDVIQKICVSGTVALGD 69

  Rat   215 YFSRPSSRANRRSRGI--VEECCFRS--CDLALLETYC 248
            .|  |:|...||.|.:  |.:.|.:|  |....|..||
  Fly    70 VF--PNSFGKRRKRDLQNVTDLCCKSGGCTYRELLQYC 105

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Igf2XP_008758296.1 IlGF 192..255 CDD:239834 19/65 (29%)
Ilp6NP_001188538.1 IlGF_like <78..105 CDD:295312 8/26 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1644517at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.